Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|187
Gene name
LocationContig_1032:3277..5373
Strand-
Gene length (bp)2096
Transcript length (bp)2034
Coding sequence length (bp)2034
Protein length (aa) 678

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 6.2E-13 578 646

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P20824|NUC1_NEUCR Phosphorus acquisition-controlling protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-1 PE=3 SV=2 1 670 3.0E-107
sp|P07270|PHO4_YEAST Phosphate system positive regulatory protein PHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO4 PE=1 SV=4 578 647 6.0E-06

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|187
MASATWSGPDQHMASTSEDDFAQFLDMGGMHFDFGAFHGPPPQQQHPAVSASPSSLSPSSRHHLDAVMAALPLPA
ASDARLAPHAVASAGTVAPAMMASAPPSSDAISSLDAQMHYLQHQKMHPQQRHDQCASSFFSVHTPSSVPPTPQS
LEMPPSNARFMAPSDQAARQPIFSSSYRPHLSDQHDVAFTPLVSPAVTPLDPHYTMDSAFAVPTAYFSPLTSPAI
HAQPDISPAYDHSSHSNNSPIEMELEPPLVSPTSASLEISKKPRKTSLVRARHKADVKGSPIAKRHRRKTGPSPS
IASQILCELDEASLGSVDQPMLPMPATPVDASDETVSLSPENLNEMPPPPLPNRQSPCQSPLVRPQNEKAQQLDP
GPLNVSNVQQSPSNPHPATPASLMRLSASQAKISAAKNRHPDANGDMMLSLHLPDSMSDVSSDSASNSQSLPPKD
QQTGPAKPLVVRPQPPSGINMPAAMSTNPSPQLRPMPLSSGPAAKKTPQLTPRGSRTRSTGSIHASPALLPRISP
SIKPLIPGTPGISIEDTASRLLASKSNYQNILEGNTVPGVSYPSELSTNLTSKRTSHKIAEQGRRNRINTALQTM
ASLLPDPPKLESVDDADKKEAKTPGNVPNSKASVVESAIEYMRQLQEENMHLRKDNQNLRTMLEKAQEGSDEAPC
ST*
Coding >OphauG2|187
ATGGCTTCTGCAACGTGGAGCGGCCCCGATCAGCACATGGCTTCAACGTCAGAAGATGATTTCGCCCAGTTCCTC
GACATGGGCGGAATGCACTTTGACTTTGGCGCCTTCCACGGCCCGCCGCCGCAACAGCAGCATCCCGCCGTCAGT
GCCTCGCCGTCGTCCCTGTCGCCGTCGTCGCGCCACCACCTCGACGCCGTCATGGCCGCGCTGCCGCTGCCCGCC
GCCAGCGACGCCCGTCTTGCACCGCATGCCGTCGCCTCGGCTGGCACTGTGGCCCCGGCCATGATGGCTTCTGCG
CCCCCGTCGTCCGACGCCATATCCAGTCTCGACGCCCAGATGCACTATCTGCAGCATCAAAAGATGCATCCGCAG
CAGCGCCACGACCAGTGCGCCTCGTCCTTCTTCTCCGTCCATACCCCGTCCTCGGTCCCTCCTACGCCCCAGAGC
CTCGAGATGCCGCCCTCAAACGCCCGCTTCATGGCCCCGTCTGACCAGGCCGCGCGACAGCCCATCTTCTCCTCC
TCGTACCGCCCACACCTGTCGGACCAGCACGACGTGGCCTTTACCCCCCTCGTATCGCCCGCCGTAACACCCTTG
GATCCGCACTACACCATGGACAGCGCCTTTGCGGTGCCCACGGCCTACTTCAGCCCTCTTACCTCGCCCGCCATT
CACGCCCAGCCCGACATCTCTCCGGCCTATGACCATAGTTCTCACTCAAATAATTCCCCCATCGAAATGGAACTC
GAGCCCCCGCTAGTGTCGCCAACCAGCGCCAGCCTAGAAATCTCCAAAAAGCCCAGGAAGACCAGTCTTGTTCGA
GCAAGGCACAAGGCCGACGTCAAGGGCTCGCCCATTGCCAAGCGCCACCGACGCAAAACCGGTCCCAGCCCCTCC
ATTGCCTCTCAGATACTCTGTGAGCTCGACGAGGCCAGCTTGGGCTCCGTTGACCAGCCAATGCTGCCAATGCCC
GCCACGCCCGTCGATGCATCCGACGAGACTGTCTCCCTTTCTCCAGAAAACCTCAACGAGATGCCTCCTCCCCCT
CTTCCCAATAGGCAGTCGCCATGCCAGTCTCCTCTTGTTCGTCCGCAAAACGAAAAGGCCCAGCAGCTTGACCCG
GGTCCTCTCAATGTTTCCAACGTGCAGCAGTCGCCATCAAATCCCCACCCGGCGACTCCAGCCTCGCTCATGAGG
TTGTCTGCTTCACAAGCAAAAATCTCAGCGGCAAAAAATAGGCATCCCGATGCCAATGGCGACATGATGCTGTCG
CTCCATCTCCCCGACTCAATGTCCGATGTATCCTCCGACTCTGCCTCAAATTCACAGTCTTTGCCGCCCAAAGAC
CAACAGACGGGCCCTGCCAAACCTCTAGTCGTCAGGCCACAGCCACCGTCGGGCATCAACATGCCTGCCGCAATG
TCAACAAATCCTAGCCCACAGCTGCGTCCCATGCCGCTTTCATCCGGACCAGCGGCCAAAAAGACGCCCCAGTTG
ACTCCTAGAGGTAGTCGAACACGCTCAACAGGCTCTATCCATGCCTCTCCCGCACTACTTCCCCGCATTTCTCCT
AGTATAAAGCCCCTCATTCCAGGCACTCCCGGCATATCTATAGAAGACACGGCGTCGCGGCTCCTTGCGTCAAAG
TCCAATTATCAAAACATACTCGAGGGAAATACGGTGCCAGGCGTATCGTATCCAAGCGAATTGTCAACAAACTTG
ACATCCAAACGGACATCGCACAAGATTGCGGAACAAGGTCGGCGAAACCGAATCAATACAGCCTTGCAAACCATG
GCCAGCCTATTGCCCGACCCGCCAAAATTGGAAAGCGTAGACGACGCCGACAAGAAGGAAGCAAAAACTCCAGGC
AATGTGCCCAATAGCAAAGCCAGTGTGGTTGAAAGCGCCATTGAGTATATGCGCCAGCTCCAAGAGGAAAACATG
CACCTTAGAAAAGACAATCAAAACCTGAGGACAATGTTAGAAAAGGCCCAAGAAGGATCTGACGAAGCACCCTGT
TCCACTTAG
Transcript >OphauG2|187
ATGGCTTCTGCAACGTGGAGCGGCCCCGATCAGCACATGGCTTCAACGTCAGAAGATGATTTCGCCCAGTTCCTC
GACATGGGCGGAATGCACTTTGACTTTGGCGCCTTCCACGGCCCGCCGCCGCAACAGCAGCATCCCGCCGTCAGT
GCCTCGCCGTCGTCCCTGTCGCCGTCGTCGCGCCACCACCTCGACGCCGTCATGGCCGCGCTGCCGCTGCCCGCC
GCCAGCGACGCCCGTCTTGCACCGCATGCCGTCGCCTCGGCTGGCACTGTGGCCCCGGCCATGATGGCTTCTGCG
CCCCCGTCGTCCGACGCCATATCCAGTCTCGACGCCCAGATGCACTATCTGCAGCATCAAAAGATGCATCCGCAG
CAGCGCCACGACCAGTGCGCCTCGTCCTTCTTCTCCGTCCATACCCCGTCCTCGGTCCCTCCTACGCCCCAGAGC
CTCGAGATGCCGCCCTCAAACGCCCGCTTCATGGCCCCGTCTGACCAGGCCGCGCGACAGCCCATCTTCTCCTCC
TCGTACCGCCCACACCTGTCGGACCAGCACGACGTGGCCTTTACCCCCCTCGTATCGCCCGCCGTAACACCCTTG
GATCCGCACTACACCATGGACAGCGCCTTTGCGGTGCCCACGGCCTACTTCAGCCCTCTTACCTCGCCCGCCATT
CACGCCCAGCCCGACATCTCTCCGGCCTATGACCATAGTTCTCACTCAAATAATTCCCCCATCGAAATGGAACTC
GAGCCCCCGCTAGTGTCGCCAACCAGCGCCAGCCTAGAAATCTCCAAAAAGCCCAGGAAGACCAGTCTTGTTCGA
GCAAGGCACAAGGCCGACGTCAAGGGCTCGCCCATTGCCAAGCGCCACCGACGCAAAACCGGTCCCAGCCCCTCC
ATTGCCTCTCAGATACTCTGTGAGCTCGACGAGGCCAGCTTGGGCTCCGTTGACCAGCCAATGCTGCCAATGCCC
GCCACGCCCGTCGATGCATCCGACGAGACTGTCTCCCTTTCTCCAGAAAACCTCAACGAGATGCCTCCTCCCCCT
CTTCCCAATAGGCAGTCGCCATGCCAGTCTCCTCTTGTTCGTCCGCAAAACGAAAAGGCCCAGCAGCTTGACCCG
GGTCCTCTCAATGTTTCCAACGTGCAGCAGTCGCCATCAAATCCCCACCCGGCGACTCCAGCCTCGCTCATGAGG
TTGTCTGCTTCACAAGCAAAAATCTCAGCGGCAAAAAATAGGCATCCCGATGCCAATGGCGACATGATGCTGTCG
CTCCATCTCCCCGACTCAATGTCCGATGTATCCTCCGACTCTGCCTCAAATTCACAGTCTTTGCCGCCCAAAGAC
CAACAGACGGGCCCTGCCAAACCTCTAGTCGTCAGGCCACAGCCACCGTCGGGCATCAACATGCCTGCCGCAATG
TCAACAAATCCTAGCCCACAGCTGCGTCCCATGCCGCTTTCATCCGGACCAGCGGCCAAAAAGACGCCCCAGTTG
ACTCCTAGAGGTAGTCGAACACGCTCAACAGGCTCTATCCATGCCTCTCCCGCACTACTTCCCCGCATTTCTCCT
AGTATAAAGCCCCTCATTCCAGGCACTCCCGGCATATCTATAGAAGACACGGCGTCGCGGCTCCTTGCGTCAAAG
TCCAATTATCAAAACATACTCGAGGGAAATACGGTGCCAGGCGTATCGTATCCAAGCGAATTGTCAACAAACTTG
ACATCCAAACGGACATCGCACAAGATTGCGGAACAAGGTCGGCGAAACCGAATCAATACAGCCTTGCAAACCATG
GCCAGCCTATTGCCCGACCCGCCAAAATTGGAAAGCGTAGACGACGCCGACAAGAAGGAAGCAAAAACTCCAGGC
AATGTGCCCAATAGCAAAGCCAGTGTGGTTGAAAGCGCCATTGAGTATATGCGCCAGCTCCAAGAGGAAAACATG
CACCTTAGAAAAGACAATCAAAACCTGAGGACAATGTTAGAAAAGGCCCAAGAAGGATCTGACGAAGCACCCTGT
TCCACTTAG
Gene >OphauG2|187
ATGGCTTCTGCAACGTGGAGCGGCCCCGATCAGCACATGGCTTCAACGTCAGAAGATGATTTCGCCCAGTTCCTC
GACATGGGCGGAATGCACTTTGACTTTGGCGCCTTCCACGGCCCGCCGCCGCAACAGCAGCATCCCGCCGTCAGT
GCCTCGCCGTCGTCCCTGTCGCCGTCGTCGCGCCACCACCTCGACGCCGTCATGGCCGCGCTGCCGCTGCCCGCC
GCCAGCGACGCCCGTCTTGCACCGCATGCCGTCGCCTCGGCTGGCACTGTGGCCCCGGCCATGATGGCTTCTGCG
CCCCCGTCGTCCGACGCCATATCCAGTCTCGACGCCCAGATGCACTATCTGCAGCATCAAAAGATGCATCCGCAG
CAGCGCCACGACCAGTGCGCCTCGTCCTTCTTCTCCGTCCATACCCCGTCCTCGGTCCCTCCTACGCCCCAGAGC
CTCGAGATGCCGCCCTCAAACGCCCGCTTCATGGCCCCGTCTGACCAGGCCGCGCGACAGCCCATCTTCTCCTCC
TCGTACCGCCCACACCTGTCGGACCAGCACGACGTGAGTTGCCTCTACAATCTTGCACAATCCTGCTCTTGGCCG
CTGCTAAAATGCCCCTCCAGGTGGCCTTTACCCCCCTCGTATCGCCCGCCGTAACACCCTTGGATCCGCACTACA
CCATGGACAGCGCCTTTGCGGTGCCCACGGCCTACTTCAGCCCTCTTACCTCGCCCGCCATTCACGCCCAGCCCG
ACATCTCTCCGGCCTATGACCATAGTTCTCACTCAAATAATTCCCCCATCGAAATGGAACTCGAGCCCCCGCTAG
TGTCGCCAACCAGCGCCAGCCTAGAAATCTCCAAAAAGCCCAGGAAGACCAGTCTTGTTCGAGCAAGGCACAAGG
CCGACGTCAAGGGCTCGCCCATTGCCAAGCGCCACCGACGCAAAACCGGTCCCAGCCCCTCCATTGCCTCTCAGA
TACTCTGTGAGCTCGACGAGGCCAGCTTGGGCTCCGTTGACCAGCCAATGCTGCCAATGCCCGCCACGCCCGTCG
ATGCATCCGACGAGACTGTCTCCCTTTCTCCAGAAAACCTCAACGAGATGCCTCCTCCCCCTCTTCCCAATAGGC
AGTCGCCATGCCAGTCTCCTCTTGTTCGTCCGCAAAACGAAAAGGCCCAGCAGCTTGACCCGGGTCCTCTCAATG
TTTCCAACGTGCAGCAGTCGCCATCAAATCCCCACCCGGCGACTCCAGCCTCGCTCATGAGGTTGTCTGCTTCAC
AAGCAAAAATCTCAGCGGCAAAAAATAGGCATCCCGATGCCAATGGCGACATGATGCTGTCGCTCCATCTCCCCG
ACTCAATGTCCGATGTATCCTCCGACTCTGCCTCAAATTCACAGTCTTTGCCGCCCAAAGACCAACAGACGGGCC
CTGCCAAACCTCTAGTCGTCAGGCCACAGCCACCGTCGGGCATCAACATGCCTGCCGCAATGTCAACAAATCCTA
GCCCACAGCTGCGTCCCATGCCGCTTTCATCCGGACCAGCGGCCAAAAAGACGCCCCAGTTGACTCCTAGAGGTA
GTCGAACACGCTCAACAGGCTCTATCCATGCCTCTCCCGCACTACTTCCCCGCATTTCTCCTAGTATAAAGCCCC
TCATTCCAGGCACTCCCGGCATATCTATAGAAGACACGGCGTCGCGGCTCCTTGCGTCAAAGTCCAATTATCAAA
ACATACTCGAGGGAAATACGGTGCCAGGCGTATCGTATCCAAGCGAATTGTCAACAAACTTGACATCCAAACGGA
CATCGCACAAGATTGCGGAACAAGGTCGGCGAAACCGAATCAATACAGCCTTGCAAACCATGGCCAGCCTATTGC
CCGACCCGCCAAAATTGGAAAGCGTAGACGACGCCGACAAGAAGGAAGCAAAAACTCCAGGCAATGTGCCCAATA
GCAAAGCCAGTGTGGTTGAAAGCGCCATTGAGTATATGCGCCAGCTCCAAGAGGAAAACATGCACCTTAGAAAAG
ACAATCAAAACCTGAGGACAATGTTAGAAAAGGCCCAAGAAGGATCTGACGAAGCACCCTGTTCCACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail