Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1858
Gene name
LocationContig_16:4807..7858
Strand-
Gene length (bp)3051
Transcript length (bp)2940
Coding sequence length (bp)2940
Protein length (aa) 980

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 1.8E-111 597 962
PF15409 PH_8 Pleckstrin homology domain 3.5E-37 219 306
PF00169 PH PH domain 1.4E-06 219 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 567 974 3.0E-114
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 468 970 1.0E-102
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 463 949 7.0E-72
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 463 940 2.0E-69
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 500 974 4.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 567 974 3.0E-114
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 468 970 1.0E-102
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 463 949 7.0E-72
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 463 940 2.0E-69
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 500 974 4.0E-69
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 443 974 9.0E-69
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 547 978 2.0E-65
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 582 978 3.0E-65
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 539 979 4.0E-64
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 597 970 1.0E-63
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 597 974 3.0E-60
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 409 979 3.0E-59
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 574 974 9.0E-56
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 582 979 5.0E-54
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 585 974 2.0E-53
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 585 974 6.0E-53
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 585 974 1.0E-52
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 512 974 3.0E-52
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 585 949 1.0E-51
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 510 974 6.0E-51
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 584 974 1.0E-50
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 584 974 6.0E-50
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 584 974 8.0E-50
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 582 974 9.0E-50
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 499 974 4.0E-48
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 576 974 1.0E-47
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 597 936 5.0E-42
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 601 943 1.0E-41
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 606 964 2.0E-41
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 602 940 5.0E-41
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 4 306 2.0E-36
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 594 962 4.0E-35
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 4 304 7.0E-24
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 606 939 4.0E-21
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 613 946 9.0E-20
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 607 936 3.0E-19
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 606 950 7.0E-19
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 606 950 1.0E-17
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 597 936 2.0E-17
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 597 936 5.0E-16
sp|Q8CI95|OSB11_MOUSE Oxysterol-binding protein-related protein 11 OS=Mus musculus GN=Osbpl11 PE=1 SV=2 606 950 2.0E-15
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 607 834 3.0E-15
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 606 951 7.0E-15
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 607 937 3.0E-14
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 598 936 6.0E-13
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 598 936 2.0E-12
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 607 976 2.0E-12
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 598 936 3.0E-12
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 598 936 8.0E-12
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 597 945 2.0E-11
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 609 959 2.0E-10
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 607 834 2.0E-10
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 607 920 1.0E-09
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 609 958 9.0E-09
sp|P35844|KES1_YEAST Oxysterol-binding protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KES1 PE=1 SV=1 609 936 2.0E-08
sp|Q86HV4|OSB6_DICDI Oxysterol-binding protein 6 OS=Dictyostelium discoideum GN=osbF PE=3 SV=1 599 817 3.0E-08
sp|Q54RM1|OSB7_DICDI Oxysterol-binding protein 7 OS=Dictyostelium discoideum GN=osbG PE=3 SV=1 605 818 4.0E-07
sp|Q8MPQ7|OSB1_DICDI Oxysterol-binding protein 1 OS=Dictyostelium discoideum GN=osbA PE=1 SV=1 606 956 1.0E-06
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 609 944 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008289 lipid binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3609
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1858 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7333
Ophiocordyceps camponoti-floridani Ophcf2|02011
Ophiocordyceps camponoti-rufipedis Ophun1|4304
Ophiocordyceps kimflemingae Ophio5|3316
Ophiocordyceps subramaniannii Hirsu2|6963

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1858
MAGIERLEVHSKSYIVRWVRVDEGNTLSWSVQPHKKSINFGIVKHPGSGATSILASNGEQVDAAHLHLSPDGKST
KSSKKDTSAQQLLTGKGFIPIKWHGKCEADKVSLGTYDVPPGQGGMYGLVFDNTFSKQTSKTATFVVLTYPTGVA
PQTAHHLPNLQLPHAQSSQSSLGKLTSPRNEAGPSASVDSLHSQNARARATSTSARSDMMASQQTYHVGTLSKRR
RKKGQGYARRFFSLDYSTCTLSYYYDRNSSALRGAIPLSLAAVAADQRRREISIDSGAEVWHLRAPNDKEFQDWA
RALEKASRVARGADSGPEPPKTGPNLIHQHSRPAQKADQAQDVEWQQIEALVSRVVGTRDALRRLTKEVAALPQP
PATAQHLAPSSAITADDSYFPPTVEKKPFWRRKSSSQALTPMLQQTAQSSTAAPSSDSAATTRPMNSNRVSKHRS
RTSMHGEQSIHDHCESLLSDLDSVVGEFTTLISNKRRRMAAPVSATGVASRLSIDSMSTDEFFDAQDNKSAVVKI
EDSDDNSTHTRDESPSNDGCSTSSSENDEDPAGTHGTGHLHPSKPKSLAPLPIDQAVSRRTTVPAPTVQPPSLIA
FVRKNVGKDLSTVSLPVSSNEPLSLLQKAAEQLEYAQLLDKATRQRSPTERLLYVTAFAVSQFSSGRAKERATRK
PFNPLLGETYELVRTDKEMPGGFRLLVEKIQHRPVRLAMQADSAHWSYSQSPSPAQKFWGKSAELTTEGRIRVVL
RLAEGGDEYYSWNIATMFLRNVVMGEKYVEPVGTMSVVNDSTGHKASVEFKSKGMFGGRSEEVQVVTHGPDGSDT
GSGLTGTWTTGLRTVGPGKAASEEVWKVGNMVDNAAHTYGLTQFAATLNEITEIEKDKMAPTDTRRRPDQRFVEQ
GRLDEAEEWKLKLEEEQRARRREAEARGETYRPRWFVKAEGTADGDEVWKMRTGKDGYWEERARGSWSNVPVIFG
EANE*
Coding >OphauG2|1858
ATGGCGGGCATCGAGAGGCTCGAAGTCCACAGCAAGTCATACATTGTGCGCTGGGTGCGTGTCGACGAGGGTAAC
ACGCTGTCATGGAGTGTCCAGCCGCACAAAAAGTCCATTAATTTTGGCATTGTCAAGCACCCAGGCAGCGGTGCC
ACAAGCATCCTGGCCTCCAATGGCGAACAGGTCGATGCTGCTCATCTCCACCTCTCGCCCGATGGCAAATCCACC
AAGAGCTCCAAGAAGGATACGTCGGCCCAGCAGCTCCTGACGGGCAAGGGCTTCATCCCCATCAAGTGGCATGGC
AAATGCGAGGCAGACAAGGTATCCTTGGGAACCTACGATGTTCCCCCGGGCCAGGGCGGCATGTACGGCCTCGTC
TTTGACAACACCTTTTCCAAACAGACGTCCAAGACAGCCACCTTTGTCGTCCTTACATACCCCACCGGTGTCGCC
CCCCAAACCGCTCACCATCTGCCCAATCTCCAGCTGCCTCACGCCCAGTCGAGCCAGTCGAGCTTGGGCAAGCTG
ACCAGCCCGCGCAACGAAGCTGGCCCCTCGGCCTCGGTCGACAGCCTGCACAGCCAAAATGCCCGCGCACGCGCT
ACCTCGACCTCGGCTCGTAGCGACATGATGGCCAGCCAGCAGACCTACCACGTTGGCACTCTATCCAAGAGGAGG
CGTAAAAAGGGGCAGGGCTATGCGCGCCGCTTCTTCTCCCTCGACTACTCCACCTGCACCCTCTCTTACTACTAT
GACCGCAACTCGTCTGCTCTGCGCGGCGCCATTCCTCTCAGCTTGGCTGCTGTCGCCGCCGACCAACGCCGCAGA
GAAATCAGCATCGACTCGGGCGCCGAGGTGTGGCACCTGAGAGCCCCCAACGACAAGGAGTTTCAAGACTGGGCT
CGAGCACTCGAAAAGGCAAGCCGAGTCGCGAGGGGCGCTGACTCGGGCCCAGAACCGCCCAAGACTGGTCCCAAT
CTGATTCACCAGCACTCGAGACCGGCGCAAAAGGCAGACCAGGCTCAAGATGTTGAGTGGCAGCAGATAGAGGCC
CTCGTCAGTCGCGTCGTCGGCACTCGAGATGCGCTTCGCCGCCTCACCAAGGAGGTTGCGGCCCTTCCTCAGCCG
CCTGCCACCGCACAGCATCTCGCGCCCTCGTCTGCCATTACTGCCGACGATAGCTACTTCCCGCCCACCGTGGAG
AAGAAGCCCTTTTGGAGGCGTAAGTCGAGCTCCCAGGCCCTGACTCCAATGCTGCAACAGACGGCCCAATCGTCC
ACGGCTGCGCCTAGTTCCGACAGCGCCGCCACGACAAGGCCCATGAATAGCAACCGCGTCTCCAAGCACCGGTCG
CGAACATCGATGCACGGCGAACAGTCCATCCACGACCACTGCGAATCCTTGTTGTCAGATCTCGACTCGGTCGTG
GGCGAATTCACCACGCTGATATCCAATAAGAGGCGGCGAATGGCGGCACCCGTGTCTGCCACTGGCGTTGCCTCC
CGCTTGAGCATTGATAGCATGTCGACGGACGAGTTCTTTGACGCACAAGATAACAAGTCGGCAGTGGTCAAGATT
GAAGACAGTGACGACAATTCGACGCATACCAGAGATGAATCCCCCAGTAACGACGGGTGCTCTACATCGTCGTCT
GAAAACGATGAGGACCCCGCAGGTACTCATGGCACTGGCCATTTGCATCCTTCAAAGCCCAAAAGCCTTGCGCCC
TTGCCCATTGACCAAGCAGTGTCGCGCAGGACTACGGTTCCGGCACCCACGGTGCAGCCGCCCAGTCTGATTGCA
TTTGTACGCAAAAACGTGGGCAAAGACTTGAGCACCGTTAGCCTGCCCGTCTCATCAAATGAGCCCCTATCATTG
CTGCAAAAGGCTGCCGAGCAGCTCGAGTATGCGCAGCTCCTTGACAAGGCGACGAGGCAAAGGAGCCCAACAGAA
AGGCTGCTCTATGTTACCGCCTTTGCCGTCTCTCAGTTCAGCAGCGGACGGGCCAAGGAGCGGGCAACACGCAAA
CCCTTCAACCCTCTGCTAGGCGAGACATATGAGCTTGTACGCACCGACAAGGAGATGCCGGGGGGCTTCAGACTT
TTGGTGGAAAAGATACAGCACCGGCCAGTGCGGCTGGCCATGCAGGCCGACTCGGCGCATTGGTCCTACTCACAG
TCGCCATCCCCTGCGCAAAAGTTCTGGGGCAAAAGTGCCGAACTTACAACCGAGGGCCGCATCAGGGTGGTGCTC
CGGCTGGCCGAGGGCGGCGATGAGTACTACTCGTGGAACATTGCCACCATGTTTCTACGCAACGTGGTCATGGGT
GAAAAGTACGTTGAGCCTGTAGGTACAATGAGCGTTGTCAACGACAGCACGGGGCACAAAGCGAGCGTTGAGTTC
AAGAGCAAAGGCATGTTTGGCGGCAGGTCCGAGGAAGTTCAGGTCGTAACACATGGGCCCGATGGAAGTGACACA
GGCAGCGGATTAACAGGTACCTGGACGACTGGGTTGCGCACCGTTGGGCCAGGCAAAGCAGCCAGCGAAGAGGTG
TGGAAGGTGGGCAACATGGTGGACAATGCAGCGCACACGTATGGCTTGACGCAGTTTGCTGCGACACTCAACGAA
ATCACGGAAATCGAAAAGGATAAGATGGCCCCGACGGATACACGGCGGCGGCCGGACCAACGGTTTGTGGAGCAA
GGGCGGCTGGACGAAGCCGAAGAGTGGAAGCTCAAGCTCGAAGAGGAACAGCGAGCGCGGCGACGCGAAGCCGAG
GCGCGGGGAGAGACATATCGACCGCGGTGGTTTGTCAAGGCCGAGGGCACAGCTGATGGCGACGAGGTGTGGAAG
ATGCGCACAGGCAAGGACGGCTATTGGGAAGAAAGAGCGCGAGGGAGCTGGAGCAACGTACCAGTTATATTTGGG
GAAGCCAACGAGTGA
Transcript >OphauG2|1858
ATGGCGGGCATCGAGAGGCTCGAAGTCCACAGCAAGTCATACATTGTGCGCTGGGTGCGTGTCGACGAGGGTAAC
ACGCTGTCATGGAGTGTCCAGCCGCACAAAAAGTCCATTAATTTTGGCATTGTCAAGCACCCAGGCAGCGGTGCC
ACAAGCATCCTGGCCTCCAATGGCGAACAGGTCGATGCTGCTCATCTCCACCTCTCGCCCGATGGCAAATCCACC
AAGAGCTCCAAGAAGGATACGTCGGCCCAGCAGCTCCTGACGGGCAAGGGCTTCATCCCCATCAAGTGGCATGGC
AAATGCGAGGCAGACAAGGTATCCTTGGGAACCTACGATGTTCCCCCGGGCCAGGGCGGCATGTACGGCCTCGTC
TTTGACAACACCTTTTCCAAACAGACGTCCAAGACAGCCACCTTTGTCGTCCTTACATACCCCACCGGTGTCGCC
CCCCAAACCGCTCACCATCTGCCCAATCTCCAGCTGCCTCACGCCCAGTCGAGCCAGTCGAGCTTGGGCAAGCTG
ACCAGCCCGCGCAACGAAGCTGGCCCCTCGGCCTCGGTCGACAGCCTGCACAGCCAAAATGCCCGCGCACGCGCT
ACCTCGACCTCGGCTCGTAGCGACATGATGGCCAGCCAGCAGACCTACCACGTTGGCACTCTATCCAAGAGGAGG
CGTAAAAAGGGGCAGGGCTATGCGCGCCGCTTCTTCTCCCTCGACTACTCCACCTGCACCCTCTCTTACTACTAT
GACCGCAACTCGTCTGCTCTGCGCGGCGCCATTCCTCTCAGCTTGGCTGCTGTCGCCGCCGACCAACGCCGCAGA
GAAATCAGCATCGACTCGGGCGCCGAGGTGTGGCACCTGAGAGCCCCCAACGACAAGGAGTTTCAAGACTGGGCT
CGAGCACTCGAAAAGGCAAGCCGAGTCGCGAGGGGCGCTGACTCGGGCCCAGAACCGCCCAAGACTGGTCCCAAT
CTGATTCACCAGCACTCGAGACCGGCGCAAAAGGCAGACCAGGCTCAAGATGTTGAGTGGCAGCAGATAGAGGCC
CTCGTCAGTCGCGTCGTCGGCACTCGAGATGCGCTTCGCCGCCTCACCAAGGAGGTTGCGGCCCTTCCTCAGCCG
CCTGCCACCGCACAGCATCTCGCGCCCTCGTCTGCCATTACTGCCGACGATAGCTACTTCCCGCCCACCGTGGAG
AAGAAGCCCTTTTGGAGGCGTAAGTCGAGCTCCCAGGCCCTGACTCCAATGCTGCAACAGACGGCCCAATCGTCC
ACGGCTGCGCCTAGTTCCGACAGCGCCGCCACGACAAGGCCCATGAATAGCAACCGCGTCTCCAAGCACCGGTCG
CGAACATCGATGCACGGCGAACAGTCCATCCACGACCACTGCGAATCCTTGTTGTCAGATCTCGACTCGGTCGTG
GGCGAATTCACCACGCTGATATCCAATAAGAGGCGGCGAATGGCGGCACCCGTGTCTGCCACTGGCGTTGCCTCC
CGCTTGAGCATTGATAGCATGTCGACGGACGAGTTCTTTGACGCACAAGATAACAAGTCGGCAGTGGTCAAGATT
GAAGACAGTGACGACAATTCGACGCATACCAGAGATGAATCCCCCAGTAACGACGGGTGCTCTACATCGTCGTCT
GAAAACGATGAGGACCCCGCAGGTACTCATGGCACTGGCCATTTGCATCCTTCAAAGCCCAAAAGCCTTGCGCCC
TTGCCCATTGACCAAGCAGTGTCGCGCAGGACTACGGTTCCGGCACCCACGGTGCAGCCGCCCAGTCTGATTGCA
TTTGTACGCAAAAACGTGGGCAAAGACTTGAGCACCGTTAGCCTGCCCGTCTCATCAAATGAGCCCCTATCATTG
CTGCAAAAGGCTGCCGAGCAGCTCGAGTATGCGCAGCTCCTTGACAAGGCGACGAGGCAAAGGAGCCCAACAGAA
AGGCTGCTCTATGTTACCGCCTTTGCCGTCTCTCAGTTCAGCAGCGGACGGGCCAAGGAGCGGGCAACACGCAAA
CCCTTCAACCCTCTGCTAGGCGAGACATATGAGCTTGTACGCACCGACAAGGAGATGCCGGGGGGCTTCAGACTT
TTGGTGGAAAAGATACAGCACCGGCCAGTGCGGCTGGCCATGCAGGCCGACTCGGCGCATTGGTCCTACTCACAG
TCGCCATCCCCTGCGCAAAAGTTCTGGGGCAAAAGTGCCGAACTTACAACCGAGGGCCGCATCAGGGTGGTGCTC
CGGCTGGCCGAGGGCGGCGATGAGTACTACTCGTGGAACATTGCCACCATGTTTCTACGCAACGTGGTCATGGGT
GAAAAGTACGTTGAGCCTGTAGGTACAATGAGCGTTGTCAACGACAGCACGGGGCACAAAGCGAGCGTTGAGTTC
AAGAGCAAAGGCATGTTTGGCGGCAGGTCCGAGGAAGTTCAGGTCGTAACACATGGGCCCGATGGAAGTGACACA
GGCAGCGGATTAACAGGTACCTGGACGACTGGGTTGCGCACCGTTGGGCCAGGCAAAGCAGCCAGCGAAGAGGTG
TGGAAGGTGGGCAACATGGTGGACAATGCAGCGCACACGTATGGCTTGACGCAGTTTGCTGCGACACTCAACGAA
ATCACGGAAATCGAAAAGGATAAGATGGCCCCGACGGATACACGGCGGCGGCCGGACCAACGGTTTGTGGAGCAA
GGGCGGCTGGACGAAGCCGAAGAGTGGAAGCTCAAGCTCGAAGAGGAACAGCGAGCGCGGCGACGCGAAGCCGAG
GCGCGGGGAGAGACATATCGACCGCGGTGGTTTGTCAAGGCCGAGGGCACAGCTGATGGCGACGAGGTGTGGAAG
ATGCGCACAGGCAAGGACGGCTATTGGGAAGAAAGAGCGCGAGGGAGCTGGAGCAACGTACCAGTTATATTTGGG
GAAGCCAACGAGTGA
Gene >OphauG2|1858
ATGGCGGGCATCGAGAGGCTCGAAGTCCACAGCAAGGCAAGGTGCTCGACCAACAGTGCTTCTGCCTCTACTAAC
CTCGCCGCAGTCATACATTGTGCGCTGGGTGCGTGTCGACGAGGGTAACACGCTGTCATGGAGTGTCCAGCCGCA
CAAAAAGTCCATGTATGGCTCCCATGGTCCTCTTGTGCCTCTGTCCCTCTGCCCCTCTGACCAGCCATGGCTAGT
AATTTTGGCATTGTCAAGCACCCAGGCAGCGGTGCCACAAGCATCCTGGCCTCCAATGGCGAACAGGTCGATGCT
GCTCATCTCCACCTCTCGCCCGATGGCAAATCCACCAAGAGCTCCAAGAAGGATACGTCGGCCCAGCAGCTCCTG
ACGGGCAAGGGCTTCATCCCCATCAAGTGGCATGGCAAATGCGAGGCAGACAAGGTATCCTTGGGAACCTACGAT
GTTCCCCCGGGCCAGGGCGGCATGTACGGCCTCGTCTTTGACAACACCTTTTCCAAACAGACGTCCAAGACAGCC
ACCTTTGTCGTCCTTACATACCCCACCGGTGTCGCCCCCCAAACCGCTCACCATCTGCCCAATCTCCAGCTGCCT
CACGCCCAGTCGAGCCAGTCGAGCTTGGGCAAGCTGACCAGCCCGCGCAACGAAGCTGGCCCCTCGGCCTCGGTC
GACAGCCTGCACAGCCAAAATGCCCGCGCACGCGCTACCTCGACCTCGGCTCGTAGCGACATGATGGCCAGCCAG
CAGACCTACCACGTTGGCACTCTATCCAAGAGGAGGCGTAAAAAGGGGCAGGGCTATGCGCGCCGCTTCTTCTCC
CTCGACTACTCCACCTGCACCCTCTCTTACTACTATGACCGCAACTCGTCTGCTCTGCGCGGCGCCATTCCTCTC
AGCTTGGCTGCTGTCGCCGCCGACCAACGCCGCAGAGAAATCAGCATCGACTCGGGCGCCGAGGTGTGGCACCTG
AGAGCCCCCAACGACAAGGAGTTTCAAGACTGGGCTCGAGCACTCGAAAAGGCAAGCCGAGTCGCGAGGGGCGCT
GACTCGGGCCCAGAACCGCCCAAGACTGGTCCCAATCTGATTCACCAGCACTCGAGACCGGCGCAAAAGGCAGAC
CAGGCTCAAGATGTTGAGTGGCAGCAGATAGAGGCCCTCGTCAGTCGCGTCGTCGGCACTCGAGATGCGCTTCGC
CGCCTCACCAAGGAGGTTGCGGCCCTTCCTCAGCCGCCTGCCACCGCACAGCATCTCGCGCCCTCGTCTGCCATT
ACTGCCGACGATAGCTACTTCCCGCCCACCGTGGAGAAGAAGCCCTTTTGGAGGCGTAAGTCGAGCTCCCAGGCC
CTGACTCCAATGCTGCAACAGACGGCCCAATCGTCCACGGCTGCGCCTAGTTCCGACAGCGCCGCCACGACAAGG
CCCATGAATAGCAACCGCGTCTCCAAGCACCGGTCGCGAACATCGATGCACGGCGAACAGTCCATCCACGACCAC
TGCGAATCCTTGTTGTCAGATCTCGACTCGGTCGTGGGCGAATTCACCACGCTGATATCCAATAAGAGGCGGCGA
ATGGCGGCACCCGTGTCTGCCACTGGCGTTGCCTCCCGCTTGAGCATTGATAGCATGTCGACGGACGAGTTCTTT
GACGCACAAGATAACAAGTCGGCAGTGGTCAAGATTGAAGACAGTGACGACAATTCGACGCATACCAGAGATGAA
TCCCCCAGTAACGACGGGTGCTCTACATCGTCGTCTGAAAACGATGAGGACCCCGCAGGTACTCATGGCACTGGC
CATTTGCATCCTTCAAAGCCCAAAAGCCTTGCGCCCTTGCCCATTGACCAAGCAGTGTCGCGCAGGACTACGGTT
CCGGCACCCACGGTGCAGCCGCCCAGTCTGATTGCATTTGTACGCAAAAACGTGGGCAAAGACTTGAGCACCGTT
AGCCTGCCCGTCTCATCAAATGAGCCCCTATCATTGCTGCAAAAGGCTGCCGAGCAGCTCGAGTATGCGCAGCTC
CTTGACAAGGCGACGAGGCAAAGGAGCCCAACAGAAAGGCTGCTCTATGTTACCGCCTTTGCCGTCTCTCAGTTC
AGCAGCGGACGGGCCAAGGAGCGGGCAACACGCAAACCCTTCAACCCTCTGCTAGGCGAGACATATGAGCTTGTA
CGCACCGACAAGGAGATGCCGGGGGGCTTCAGACTTTTGGTGGAAAAGATACAGCACCGGCCAGTGCGGCTGGCC
ATGCAGGCCGACTCGGCGCATTGGTCCTACTCACAGTCGCCATCCCCTGCGCAAAAGTTCTGGGGCAAAAGTGCC
GAACTTACAACCGAGGGCCGCATCAGGGTGGTGCTCCGGCTGGCCGAGGGCGGCGATGAGTACTACTCGTGGAAC
ATTGCCACCATGTTTCTACGCAACGTGGTCATGGGTGAAAAGTACGTTGAGCCTGTAGGTACAATGAGCGTTGTC
AACGACAGCACGGGGCACAAAGCGAGCGTTGAGTTCAAGAGCAAAGGCATGTTTGGCGGCAGGTCCGAGGAAGTT
CAGGTCGTAACACATGGGCCCGATGGAAGTGACACAGGCAGCGGATTAACAGGTACCTGGACGACTGGGTTGCGC
ACCGTTGGGCCAGGCAAAGCAGCCAGCGAAGAGGTGTGGAAGGTGGGCAACATGGTGGACAATGCAGCGCACACG
TATGGCTTGACGCAGTTTGCTGCGACACTCAACGAAATCACGGAAATCGAAAAGGATAAGATGGCCCCGACGGAT
ACACGGCGGCGGCCGGACCAACGGTTTGTGGAGCAAGGGCGGCTGGACGAAGCCGAAGAGTGGAAGCTCAAGCTC
GAAGAGGAACAGCGAGCGCGGCGACGCGAAGCCGAGGCGCGGGGAGAGACATATCGACCGCGGTGGTTTGTCAAG
GCCGAGGGCACAGCTGATGGCGACGAGGTGTGGAAGATGCGCACAGGCAAGGACGGCTATTGGGAAGAAAGAGCG
CGAGGGAGCTGGAGCAACGTACCAGTTATATTTGGGGAAGCCAACGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail