Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1844
Gene name
LocationContig_159:19115..19995
Strand+
Gene length (bp)880
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00380 Ribosomal_S9 Ribosomal protein S9/S16 1.6E-40 149 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S7R6|RT09_NEUCR 37S ribosomal protein S9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-9 PE=3 SV=2 29 269 2.0E-100
sp|Q6CJ65|RT09_KLULA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPS9 PE=3 SV=1 25 269 1.0E-49
sp|P38120|RT09_YEAST 37S ribosomal protein S9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS9 PE=1 SV=1 30 269 2.0E-49
sp|Q9P4C1|RT09_KLUMA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces marxianus GN=MRPS9 PE=3 SV=1 5 269 3.0E-49
sp|O94150|RT09_CANAL 37S ribosomal protein S9, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPS9 PE=2 SV=1 26 269 1.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S7R6|RT09_NEUCR 37S ribosomal protein S9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mrp-9 PE=3 SV=2 29 269 2.0E-100
sp|Q6CJ65|RT09_KLULA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPS9 PE=3 SV=1 25 269 1.0E-49
sp|P38120|RT09_YEAST 37S ribosomal protein S9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS9 PE=1 SV=1 30 269 2.0E-49
sp|Q9P4C1|RT09_KLUMA 37S ribosomal protein S9, mitochondrial OS=Kluyveromyces marxianus GN=MRPS9 PE=3 SV=1 5 269 3.0E-49
sp|O94150|RT09_CANAL 37S ribosomal protein S9, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRPS9 PE=2 SV=1 26 269 1.0E-44
sp|Q6FL25|RT09_CANGA 37S ribosomal protein S9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPS9 PE=3 SV=1 30 269 2.0E-44
sp|Q757I0|RT09_ASHGO 37S ribosomal protein S9, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPS9 PE=3 SV=1 89 269 2.0E-43
sp|O14006|RT09_SCHPO 37S ribosomal protein S9, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps9 PE=1 SV=2 32 269 4.0E-42
sp|Q6BIJ5|RT09_DEBHA 37S ribosomal protein S9, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPS9 PE=3 SV=2 55 269 8.0E-39
sp|Q6CFK6|RT09_YARLI 37S ribosomal protein S9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPS9 PE=3 SV=1 87 269 7.0E-33
sp|B6IMQ2|RS9_RHOCS 30S ribosomal protein S9 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsI PE=3 SV=1 134 269 2.0E-30
sp|B2IK87|RS9_BEII9 30S ribosomal protein S9 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsI PE=3 SV=1 139 269 4.0E-30
sp|Q3A9V2|RS9_CARHZ 30S ribosomal protein S9 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsI PE=3 SV=1 147 269 7.0E-29
sp|A9W606|RS9_METEP 30S ribosomal protein S9 OS=Methylobacterium extorquens (strain PA1) GN=rpsI PE=3 SV=1 139 269 1.0E-28
sp|B7KPU6|RS9_METC4 30S ribosomal protein S9 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsI PE=3 SV=1 139 269 1.0E-28
sp|B0K5S8|RS9_THEPX 30S ribosomal protein S9 OS=Thermoanaerobacter sp. (strain X514) GN=rpsI PE=3 SV=1 147 269 2.0E-27
sp|B0KCN5|RS9_THEP3 30S ribosomal protein S9 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsI PE=3 SV=1 147 269 2.0E-27
sp|A9IVX6|RS9_BART1 30S ribosomal protein S9 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsI PE=3 SV=1 139 269 2.0E-27
sp|B2HCZ1|RS9_MYCMM 30S ribosomal protein S9 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsI PE=3 SV=1 142 269 3.0E-27
sp|A0L481|RS9_MAGMM 30S ribosomal protein S9 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsI PE=3 SV=1 147 269 3.0E-27
sp|A8I7Z9|RS9_AZOC5 30S ribosomal protein S9 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsI PE=3 SV=1 139 269 4.0E-27
sp|A0QKT2|RS9_MYCA1 30S ribosomal protein S9 OS=Mycobacterium avium (strain 104) GN=rpsI PE=3 SV=1 114 269 6.0E-27
sp|B8D7S5|RS9_BUCAT 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpsI PE=3 SV=1 147 269 6.0E-27
sp|C5BS65|RS9_TERTT 30S ribosomal protein S9 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpsI PE=3 SV=1 147 269 7.0E-27
sp|A0QSP9|RS9_MYCS2 30S ribosomal protein S9 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsI PE=1 SV=1 134 269 7.0E-27
sp|A5D5F7|RS9_PELTS 30S ribosomal protein S9 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsI PE=3 SV=1 147 269 9.0E-27
sp|Q73S30|RS9_MYCPA 30S ribosomal protein S9 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsI PE=3 SV=1 114 269 1.0E-26
sp|A4XJ60|RS9_CALS8 30S ribosomal protein S9 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsI PE=3 SV=2 144 269 1.0E-26
sp|B1J1W9|RS9_PSEPW 30S ribosomal protein S9 OS=Pseudomonas putida (strain W619) GN=rpsI PE=3 SV=1 147 269 1.0E-26
sp|B1ZCB4|RS9_METPB 30S ribosomal protein S9 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsI PE=3 SV=1 139 269 1.0E-26
sp|P57470|RS9_BUCAI 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsI PE=3 SV=1 147 269 1.0E-26
sp|B8D9H3|RS9_BUCA5 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpsI PE=3 SV=1 147 269 1.0E-26
sp|Q1BCZ0|RS9_MYCSS 30S ribosomal protein S9 OS=Mycobacterium sp. (strain MCS) GN=rpsI PE=3 SV=1 107 269 1.0E-26
sp|A1UC03|RS9_MYCSK 30S ribosomal protein S9 OS=Mycobacterium sp. (strain KMS) GN=rpsI PE=3 SV=1 107 269 1.0E-26
sp|A3PVN4|RS9_MYCSJ 30S ribosomal protein S9 OS=Mycobacterium sp. (strain JLS) GN=rpsI PE=3 SV=1 107 269 1.0E-26
sp|A1U3H7|RS9_MARHV 30S ribosomal protein S9 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|B1KII1|RS9_SHEWM 30S ribosomal protein S9 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A8FR86|RS9_SHESH 30S ribosomal protein S9 OS=Shewanella sediminis (strain HAW-EB3) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A1RNJ7|RS9_SHESW 30S ribosomal protein S9 OS=Shewanella sp. (strain W3-18-1) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|Q0HYX4|RS9_SHESR 30S ribosomal protein S9 OS=Shewanella sp. (strain MR-7) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|Q0HF31|RS9_SHESM 30S ribosomal protein S9 OS=Shewanella sp. (strain MR-4) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A0KT12|RS9_SHESA 30S ribosomal protein S9 OS=Shewanella sp. (strain ANA-3) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A4Y3E2|RS9_SHEPC 30S ribosomal protein S9 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|Q8EAG3|RS9_SHEON 30S ribosomal protein S9 OS=Shewanella oneidensis (strain MR-1) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A9L112|RS9_SHEB9 30S ribosomal protein S9 OS=Shewanella baltica (strain OS195) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A6WJ71|RS9_SHEB8 30S ribosomal protein S9 OS=Shewanella baltica (strain OS185) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A3D8R3|RS9_SHEB5 30S ribosomal protein S9 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|B8E9M8|RS9_SHEB2 30S ribosomal protein S9 OS=Shewanella baltica (strain OS223) GN=rpsI PE=3 SV=1 147 269 2.0E-26
sp|A7INH2|RS9_XANP2 30S ribosomal protein S9 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsI PE=3 SV=1 139 269 3.0E-26
sp|A0PMD2|RS9_MYCUA 30S ribosomal protein S9 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsI PE=3 SV=1 142 269 3.0E-26
sp|P40828|RS9_MYCLE 30S ribosomal protein S9 OS=Mycobacterium leprae (strain TN) GN=rpsI PE=3 SV=1 142 269 4.0E-26
sp|B8ZUC0|RS9_MYCLB 30S ribosomal protein S9 OS=Mycobacterium leprae (strain Br4923) GN=rpsI PE=3 SV=1 142 269 4.0E-26
sp|B0UQW5|RS9_METS4 30S ribosomal protein S9 OS=Methylobacterium sp. (strain 4-46) GN=rpsI PE=3 SV=1 139 269 4.0E-26
sp|Q60AF7|RS9_METCA 30S ribosomal protein S9 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsI PE=3 SV=1 147 269 4.0E-26
sp|A9I240|RS9_BORPD 30S ribosomal protein S9 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpsI PE=3 SV=1 147 269 5.0E-26
sp|Q2RSE4|RS9_RHORT 30S ribosomal protein S9 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsI PE=3 SV=1 131 269 6.0E-26
sp|B8IUF0|RS9_METNO 30S ribosomal protein S9 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsI PE=3 SV=1 139 269 6.0E-26
sp|Q88N96|RS9_PSEPK 30S ribosomal protein S9 OS=Pseudomonas putida (strain KT2440) GN=rpsI PE=3 SV=1 147 269 6.0E-26
sp|A5W8S0|RS9_PSEP1 30S ribosomal protein S9 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsI PE=3 SV=1 147 269 6.0E-26
sp|Q15PI4|RS9_PSEA6 30S ribosomal protein S9 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsI PE=3 SV=1 147 269 8.0E-26
sp|B0KFU7|RS9_PSEPG 30S ribosomal protein S9 OS=Pseudomonas putida (strain GB-1) GN=rpsI PE=3 SV=1 147 269 9.0E-26
sp|Q1I597|RS9_PSEE4 30S ribosomal protein S9 OS=Pseudomonas entomophila (strain L48) GN=rpsI PE=3 SV=1 147 269 9.0E-26
sp|Q2IWN6|RS9_RHOP2 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsI PE=3 SV=1 139 269 1.0E-25
sp|C1DQ79|RS9_AZOVD 30S ribosomal protein S9 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsI PE=3 SV=1 147 269 1.0E-25
sp|B0TUV6|RS9_SHEHH 30S ribosomal protein S9 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpsI PE=3 SV=1 147 269 1.0E-25
sp|A7HXB2|RS9_PARL1 30S ribosomal protein S9 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsI PE=3 SV=1 139 269 1.0E-25
sp|Q4K6H3|RS9_PSEF5 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsI PE=3 SV=1 147 269 1.0E-25
sp|A4WUK1|RS9_RHOS5 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsI PE=3 SV=1 135 269 1.0E-25
sp|Q6G3I7|RS9_BARHE 30S ribosomal protein S9 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpsI PE=3 SV=1 139 269 2.0E-25
sp|Q92QR5|RS9_RHIME 30S ribosomal protein S9 OS=Rhizobium meliloti (strain 1021) GN=rpsI PE=3 SV=1 139 269 2.0E-25
sp|Q4ZNX3|RS9_PSEU2 30S ribosomal protein S9 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|Q87WW8|RS9_PSESM 30S ribosomal protein S9 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|Q48EE1|RS9_PSE14 30S ribosomal protein S9 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|C4K5S1|RS9_HAMD5 30S ribosomal protein S9 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|Q7VLF7|RS9_HAEDU 30S ribosomal protein S9 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|Q3K724|RS9_PSEPF 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|C3K6E2|RS9_PSEFS 30S ribosomal protein S9 OS=Pseudomonas fluorescens (strain SBW25) GN=rpsI PE=3 SV=1 147 269 2.0E-25
sp|B3QKG4|RS9_RHOPT 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsI PE=3 SV=1 139 269 3.0E-25
sp|Q6N650|RS9_RHOPA 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsI PE=1 SV=1 139 269 3.0E-25
sp|Q8UFZ8|RS9_AGRFC 30S ribosomal protein S9 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsI PE=3 SV=1 139 269 3.0E-25
sp|B9MLF6|RS9_CALBD 30S ribosomal protein S9 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsI PE=3 SV=1 147 269 3.0E-25
sp|A1UT84|RS9_BARBK 30S ribosomal protein S9 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsI PE=3 SV=1 116 269 3.0E-25
sp|Q8R7Y9|RS9_CALS4 30S ribosomal protein S9 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|B0BUG0|RS9_ACTPJ 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|B3H130|RS9_ACTP7 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|Q21FV9|RS9_SACD2 30S ribosomal protein S9 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|P31782|RS9_HISSO 30S ribosomal protein S9 OS=Histophilus somni GN=rpsI PE=3 SV=2 147 269 4.0E-25
sp|B0UTU5|RS9_HISS2 30S ribosomal protein S9 OS=Histophilus somni (strain 2336) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|Q0I2N2|RS9_HAES1 30S ribosomal protein S9 OS=Haemophilus somnus (strain 129Pt) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|Q7W3Z2|RS9_BORPA 30S ribosomal protein S9 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpsI PE=3 SV=1 147 269 4.0E-25
sp|Q1QKK3|RS9_NITHX 30S ribosomal protein S9 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsI PE=3 SV=1 139 269 5.0E-25
sp|A4VIF8|RS9_PSEU5 30S ribosomal protein S9 OS=Pseudomonas stutzeri (strain A1501) GN=rpsI PE=3 SV=1 147 269 5.0E-25
sp|B8ENN1|RS9_METSB 30S ribosomal protein S9 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsI PE=3 SV=1 139 269 6.0E-25
sp|P62669|RS9_THET2 30S ribosomal protein S9 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsI PE=1 SV=1 147 269 6.0E-25
sp|A1KWD5|RS9_NEIMF 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsI PE=3 SV=1 147 269 6.0E-25
sp|P66642|RS9_NEIMB 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsI PE=3 SV=1 147 269 6.0E-25
sp|P66641|RS9_NEIMA 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsI PE=3 SV=1 147 269 6.0E-25
sp|A9M088|RS9_NEIM0 30S ribosomal protein S9 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsI PE=3 SV=1 147 269 6.0E-25
sp|B9KT42|RS9_RHOSK 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsI PE=3 SV=1 135 269 7.0E-25
sp|Q3J1Z5|RS9_RHOS4 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsI PE=3 SV=1 135 269 7.0E-25
sp|A3PK94|RS9_RHOS1 30S ribosomal protein S9 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsI PE=3 SV=1 135 269 7.0E-25
sp|A8H8M0|RS9_SHEPA 30S ribosomal protein S9 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpsI PE=3 SV=1 147 269 7.0E-25
sp|A5EKC6|RS9_BRASB 30S ribosomal protein S9 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsI PE=3 SV=1 139 269 7.0E-25
sp|Q07MN9|RS9_RHOP5 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsI PE=3 SV=1 139 269 7.0E-25
sp|Q5P7T8|RS9_AROAE 30S ribosomal protein S9 OS=Aromatoleum aromaticum (strain EbN1) GN=rpsI PE=3 SV=1 147 269 7.0E-25
sp|B5FB54|RS9_VIBFM 30S ribosomal protein S9 OS=Vibrio fischeri (strain MJ11) GN=rpsI PE=3 SV=1 147 269 7.0E-25
sp|Q5E2N0|RS9_VIBF1 30S ribosomal protein S9 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsI PE=3 SV=1 147 269 7.0E-25
sp|A0KPZ2|RS9_AERHH 30S ribosomal protein S9 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsI PE=3 SV=1 147 269 7.0E-25
sp|C3MA32|RS9_RHISN 30S ribosomal protein S9 OS=Rhizobium sp. (strain NGR234) GN=rpsI PE=3 SV=1 139 269 9.0E-25
sp|A4FPH0|RS9_SACEN 30S ribosomal protein S9 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rpsI PE=3 SV=1 113 269 9.0E-25
sp|A4SHZ5|RS9_AERS4 30S ribosomal protein S9 OS=Aeromonas salmonicida (strain A449) GN=rpsI PE=3 SV=1 147 269 9.0E-25
sp|Q32BA9|RS9_SHIDS 30S ribosomal protein S9 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|A3QI61|RS9_SHELP 30S ribosomal protein S9 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|Q4UKS7|RS9_RICFE 30S ribosomal protein S9 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsI PE=3 SV=1 121 269 1.0E-24
sp|Q2KV03|RS9_BORA1 30S ribosomal protein S9 OS=Bordetella avium (strain 197N) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|Q982W9|RS9_RHILO 30S ribosomal protein S9 OS=Rhizobium loti (strain MAFF303099) GN=rpsI PE=3 SV=1 139 269 1.0E-24
sp|A8GK02|RS9_SERP5 30S ribosomal protein S9 OS=Serratia proteamaculans (strain 568) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|B1M201|RS9_METRJ 30S ribosomal protein S9 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsI PE=3 SV=1 139 269 1.0E-24
sp|Q3SSQ8|RS9_NITWN 30S ribosomal protein S9 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsI PE=3 SV=1 139 269 1.0E-24
sp|Q7VUV9|RS9_BORPE 30S ribosomal protein S9 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|A8GMN0|RS9_RICAH 30S ribosomal protein S9 OS=Rickettsia akari (strain Hartford) GN=rpsI PE=3 SV=1 127 269 1.0E-24
sp|Q7WFC4|RS9_BORBR 30S ribosomal protein S9 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|A6VPF4|RS9_ACTSZ 30S ribosomal protein S9 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|Q87SI4|RS9_VIBPA 30S ribosomal protein S9 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|A4XQQ4|RS9_PSEMY 30S ribosomal protein S9 OS=Pseudomonas mendocina (strain ymp) GN=rpsI PE=3 SV=1 147 269 1.0E-24
sp|Q5Z1H9|RS9_NOCFA 30S ribosomal protein S9 OS=Nocardia farcinica (strain IFM 10152) GN=rpsI PE=3 SV=1 131 269 2.0E-24
sp|C0RIC5|RS9_BRUMB 30S ribosomal protein S9 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|B6JGT6|RS9_OLICO 30S ribosomal protein S9 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsI PE=3 SV=1 135 269 2.0E-24
sp|Q8YGJ0|RS9_BRUME 30S ribosomal protein S9 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|P80374|RS9_THET8 30S ribosomal protein S9 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsI PE=1 SV=3 147 269 2.0E-24
sp|C4LCK6|RS9_TOLAT 30S ribosomal protein S9 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsI PE=3 SV=1 147 269 2.0E-24
sp|A3MZW7|RS9_ACTP2 30S ribosomal protein S9 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsI PE=3 SV=1 147 269 2.0E-24
sp|B6ELJ4|RS9_ALISL 30S ribosomal protein S9 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsI PE=3 SV=1 147 269 2.0E-24
sp|Q8G1C9|RS9_BRUSU 30S ribosomal protein S9 OS=Brucella suis biovar 1 (strain 1330) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|B0CLB7|RS9_BRUSI 30S ribosomal protein S9 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|A5VPX4|RS9_BRUO2 30S ribosomal protein S9 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|A9MAG7|RS9_BRUC2 30S ribosomal protein S9 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|B3PBL9|RS9_CELJU 30S ribosomal protein S9 OS=Cellvibrio japonicus (strain Ueda107) GN=rpsI PE=3 SV=1 147 269 2.0E-24
sp|A6X1V5|RS9_OCHA4 30S ribosomal protein S9 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsI PE=3 SV=1 139 269 2.0E-24
sp|A1SA66|RS9_SHEAM 30S ribosomal protein S9 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsI PE=3 SV=1 147 269 3.0E-24
sp|B1I1E6|RS9_DESAP 30S ribosomal protein S9 OS=Desulforudis audaxviator (strain MP104C) GN=rpsI PE=3 SV=1 147 269 3.0E-24
sp|Q0SQH9|RS9_CLOPS 30S ribosomal protein S9 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsI PE=3 SV=1 146 269 3.0E-24
sp|Q8XHV7|RS9_CLOPE 30S ribosomal protein S9 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsI PE=3 SV=1 146 269 3.0E-24
sp|Q0TMT2|RS9_CLOP1 30S ribosomal protein S9 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsI PE=3 SV=1 146 269 3.0E-24
sp|B7VIY4|RS9_VIBTL 30S ribosomal protein S9 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsI PE=3 SV=1 147 269 3.0E-24
sp|B8F3F7|RS9_HAEPS 30S ribosomal protein S9 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpsI PE=3 SV=1 147 269 3.0E-24
sp|B2VGU9|RS9_ERWT9 30S ribosomal protein S9 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsI PE=3 SV=1 147 269 3.0E-24
sp|Q1RK10|RS9_RICBR 30S ribosomal protein S9 OS=Rickettsia bellii (strain RML369-C) GN=rpsI PE=3 SV=1 139 269 3.0E-24
sp|A8GXN6|RS9_RICB8 30S ribosomal protein S9 OS=Rickettsia bellii (strain OSU 85-389) GN=rpsI PE=3 SV=1 139 269 3.0E-24
sp|A7MWN0|RS9_VIBCB 30S ribosomal protein S9 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsI PE=3 SV=1 147 269 3.0E-24
sp|Q89KE5|RS9_BRADU 30S ribosomal protein S9 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsI PE=3 SV=1 139 269 3.0E-24
sp|A4YVP2|RS9_BRASO 30S ribosomal protein S9 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsI PE=3 SV=1 139 269 4.0E-24
sp|A6VXZ2|RS9_MARMS 30S ribosomal protein S9 OS=Marinomonas sp. (strain MWYL1) GN=rpsI PE=3 SV=1 147 269 4.0E-24
sp|A4WF42|RS9_ENT38 30S ribosomal protein S9 OS=Enterobacter sp. (strain 638) GN=rpsI PE=3 SV=1 147 269 4.0E-24
sp|Q9A8H6|RS9_CAUCR 30S ribosomal protein S9 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsI PE=3 SV=1 128 269 4.0E-24
sp|B8H554|RS9_CAUCN 30S ribosomal protein S9 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsI PE=3 SV=1 128 269 4.0E-24
sp|B8CIP3|RS9_SHEPW 30S ribosomal protein S9 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpsI PE=3 SV=1 147 269 4.0E-24
sp|A5UEV9|RS9_HAEIG 30S ribosomal protein S9 OS=Haemophilus influenzae (strain PittGG) GN=rpsI PE=3 SV=1 147 269 4.0E-24
sp|A5UC54|RS9_HAEIE 30S ribosomal protein S9 OS=Haemophilus influenzae (strain PittEE) GN=rpsI PE=3 SV=1 147 269 4.0E-24
sp|Q4QKG9|RS9_HAEI8 30S ribosomal protein S9 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsI PE=3 SV=1 147 269 4.0E-24
sp|Q6DAE6|RS9_PECAS 30S ribosomal protein S9 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsI PE=3 SV=1 147 269 5.0E-24
sp|A8GRA1|RS9_RICRS 30S ribosomal protein S9 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsI PE=3 SV=1 139 269 5.0E-24
sp|B0BWQ1|RS9_RICRO 30S ribosomal protein S9 OS=Rickettsia rickettsii (strain Iowa) GN=rpsI PE=3 SV=1 139 269 5.0E-24
sp|Q57DW2|RS9_BRUAB 30S ribosomal protein S9 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsI PE=3 SV=1 139 269 5.0E-24
sp|Q2YND9|RS9_BRUA2 30S ribosomal protein S9 OS=Brucella abortus (strain 2308) GN=rpsI PE=3 SV=1 139 269 5.0E-24
sp|B2S535|RS9_BRUA1 30S ribosomal protein S9 OS=Brucella abortus (strain S19) GN=rpsI PE=3 SV=1 139 269 5.0E-24
sp|Q92IV4|RS9_RICCN 30S ribosomal protein S9 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsI PE=3 SV=1 131 269 6.0E-24
sp|C0PZN9|RS9_SALPC 30S ribosomal protein S9 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A6U7T6|RS9_SINMW 30S ribosomal protein S9 OS=Sinorhizobium medicae (strain WSM419) GN=rpsI PE=3 SV=1 139 269 6.0E-24
sp|Q3YX18|RS9_SHISS 30S ribosomal protein S9 OS=Shigella sonnei (strain Ss046) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|C5B748|RS9_EDWI9 30S ribosomal protein S9 OS=Edwardsiella ictaluri (strain 93-146) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A9KJF4|RS9_CLOPH 30S ribosomal protein S9 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B1WQT9|RS9_CYAA5 30S ribosomal protein S9 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|Q0T058|RS9_SHIF8 30S ribosomal protein S9 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|Q31W98|RS9_SHIBS 30S ribosomal protein S9 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B2U1V5|RS9_SHIB3 30S ribosomal protein S9 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A6TEN8|RS9_KLEP7 30S ribosomal protein S9 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|Q1R6B0|RS9_ECOUT 30S ribosomal protein S9 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B1LGJ6|RS9_ECOSM 30S ribosomal protein S9 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B6I1U8|RS9_ECOSE 30S ribosomal protein S9 OS=Escherichia coli (strain SE11) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7NDK8|RS9_ECOLU 30S ribosomal protein S9 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|P0A7X3|RS9_ECOLI 30S ribosomal protein S9 OS=Escherichia coli (strain K12) GN=rpsI PE=1 SV=2 147 269 6.0E-24
sp|B1IQP9|RS9_ECOLC 30S ribosomal protein S9 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|P0A7X4|RS9_ECOL6 30S ribosomal protein S9 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsI PE=3 SV=2 147 269 6.0E-24
sp|Q0TCN6|RS9_ECOL5 30S ribosomal protein S9 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A1AGC3|RS9_ECOK1 30S ribosomal protein S9 OS=Escherichia coli O1:K1 / APEC GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A8A539|RS9_ECOHS 30S ribosomal protein S9 OS=Escherichia coli O9:H4 (strain HS) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B1XHK3|RS9_ECODH 30S ribosomal protein S9 OS=Escherichia coli (strain K12 / DH10B) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|C4ZSW8|RS9_ECOBW 30S ribosomal protein S9 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7M0U2|RS9_ECO8A 30S ribosomal protein S9 OS=Escherichia coli O8 (strain IAI1) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7N102|RS9_ECO81 30S ribosomal protein S9 OS=Escherichia coli O81 (strain ED1a) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7NKU2|RS9_ECO7I 30S ribosomal protein S9 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B5YSV6|RS9_ECO5E 30S ribosomal protein S9 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|P0A7X5|RS9_ECO57 30S ribosomal protein S9 OS=Escherichia coli O157:H7 GN=rpsI PE=3 SV=2 147 269 6.0E-24
sp|B7LHT8|RS9_ECO55 30S ribosomal protein S9 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7MBZ1|RS9_ECO45 30S ribosomal protein S9 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7UJW2|RS9_ECO27 30S ribosomal protein S9 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A7ZSC4|RS9_ECO24 30S ribosomal protein S9 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|A8AQC0|RS9_CITK8 30S ribosomal protein S9 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsI PE=3 SV=1 147 269 6.0E-24
sp|B7KI15|RS9_CYAP7 30S ribosomal protein S9 OS=Cyanothece sp. (strain PCC 7424) GN=rpsI PE=3 SV=1 147 269 7.0E-24
sp|Q2NWI3|RS9_SODGM 30S ribosomal protein S9 OS=Sodalis glossinidius (strain morsitans) GN=rpsI PE=3 SV=1 147 269 8.0E-24
sp|C0ZW78|RS9_RHOE4 30S ribosomal protein S9 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rpsI PE=3 SV=1 137 269 9.0E-24
sp|P44388|RS9_HAEIN 30S ribosomal protein S9 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsI PE=3 SV=2 147 269 9.0E-24
sp|B4RQK5|RS9_NEIG2 30S ribosomal protein S9 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|Q5F5A4|RS9_NEIG1 30S ribosomal protein S9 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B0S3F6|RS9_FINM2 30S ribosomal protein S9 OS=Finegoldia magna (strain ATCC 29328) GN=rpsI PE=3 SV=1 144 269 1.0E-23
sp|Q136Q2|RS9_RHOPS 30S ribosomal protein S9 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsI PE=3 SV=1 139 269 1.0E-23
sp|Q7MNX0|RS9_VIBVY 30S ribosomal protein S9 OS=Vibrio vulnificus (strain YJ016) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|Q8DEJ0|RS9_VIBVU 30S ribosomal protein S9 OS=Vibrio vulnificus (strain CMCP6) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|C5CM23|RS9_VARPS 30S ribosomal protein S9 OS=Variovorax paradoxus (strain S110) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|P66643|RS9_SALTY 30S ribosomal protein S9 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsI PE=1 SV=2 147 269 1.0E-23
sp|P66644|RS9_SALTI 30S ribosomal protein S9 OS=Salmonella typhi GN=rpsI PE=3 SV=2 147 269 1.0E-23
sp|B4TWJ4|RS9_SALSV 30S ribosomal protein S9 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B5BGP9|RS9_SALPK 30S ribosomal protein S9 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|A9N839|RS9_SALPB 30S ribosomal protein S9 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|Q5PJS6|RS9_SALPA 30S ribosomal protein S9 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B4T754|RS9_SALNS 30S ribosomal protein S9 OS=Salmonella newport (strain SL254) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B4TJR8|RS9_SALHS 30S ribosomal protein S9 OS=Salmonella heidelberg (strain SL476) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B5R0L7|RS9_SALEP 30S ribosomal protein S9 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B5FIS2|RS9_SALDC 30S ribosomal protein S9 OS=Salmonella dublin (strain CT_02021853) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|Q57JC4|RS9_SALCH 30S ribosomal protein S9 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|A9MNY1|RS9_SALAR 30S ribosomal protein S9 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B5F7K4|RS9_SALA4 30S ribosomal protein S9 OS=Salmonella agona (strain SL483) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|C6DIQ2|RS9_PECCP 30S ribosomal protein S9 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B5XSS2|RS9_KLEP3 30S ribosomal protein S9 OS=Klebsiella pneumoniae (strain 342) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|B7LRJ8|RS9_ESCF3 30S ribosomal protein S9 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|C4K0V7|RS9_RICPU 30S ribosomal protein S9 OS=Rickettsia peacockii (strain Rustic) GN=rpsI PE=3 SV=1 131 269 1.0E-23
sp|Q83Q07|RS9_SHIFL 30S ribosomal protein S9 OS=Shigella flexneri GN=rpsI PE=3 SV=3 147 269 1.0E-23
sp|C4ZI84|RS9_EUBR3 30S ribosomal protein S9 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsI PE=3 SV=1 147 269 1.0E-23
sp|Q0BZT3|RS9_HYPNA 30S ribosomal protein S9 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsI PE=3 SV=1 139 269 2.0E-23
sp|C3PMT0|RS9_RICAE 30S ribosomal protein S9 OS=Rickettsia africae (strain ESF-5) GN=rpsI PE=3 SV=1 131 269 2.0E-23
sp|Q0AUL6|RS9_SYNWW 30S ribosomal protein S9 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsI PE=3 SV=1 147 269 2.0E-23
sp|A3DGC4|RS9_CLOTH 30S ribosomal protein S9 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsI PE=3 SV=1 147 269 2.0E-23
sp|Q493Y5|RS9_BLOPB 30S ribosomal protein S9 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsI PE=3 SV=1 147 269 2.0E-23
sp|B4EXM0|RS9_PROMH 30S ribosomal protein S9 OS=Proteus mirabilis (strain HI4320) GN=rpsI PE=3 SV=1 147 269 2.0E-23
sp|Q2K9W4|RS9_RHIEC 30S ribosomal protein S9 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsI PE=3 SV=1 139 269 2.0E-23
sp|B2A4Q7|RS9_NATTJ 30S ribosomal protein S9 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsI PE=3 SV=1 147 269 2.0E-23
sp|P73293|RS9_SYNY3 30S ribosomal protein S9 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpsI PE=3 SV=1 147 269 3.0E-23
sp|B3E0U1|RS9_METI4 30S ribosomal protein S9 OS=Methylacidiphilum infernorum (isolate V4) GN=rpsI PE=3 SV=1 147 269 3.0E-23
sp|Q65T21|RS9_MANSM 30S ribosomal protein S9 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsI PE=3 SV=1 147 269 3.0E-23
sp|B5ZXZ5|RS9_RHILW 30S ribosomal protein S9 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsI PE=3 SV=1 139 269 3.0E-23
sp|Q7N079|RS9_PHOLL 30S ribosomal protein S9 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsI PE=3 SV=1 147 269 3.0E-23
sp|A8F0Z2|RS9_RICM5 30S ribosomal protein S9 OS=Rickettsia massiliae (strain Mtu5) GN=rpsI PE=3 SV=1 131 269 3.0E-23
sp|Q1MIP3|RS9_RHIL3 30S ribosomal protein S9 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsI PE=3 SV=1 139 269 3.0E-23
sp|Q3SF20|RS9_THIDA 30S ribosomal protein S9 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsI PE=3 SV=1 147 269 3.0E-23
sp|Q3ZZP2|RS9_DEHMC 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsI PE=3 SV=1 146 269 3.0E-23
sp|B1JL67|RS9_YERPY 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|Q665L0|RS9_YERPS 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|A4THJ2|RS9_YERPP 30S ribosomal protein S9 OS=Yersinia pestis (strain Pestoides F) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|Q1CE09|RS9_YERPN 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|A9R1R9|RS9_YERPG 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|Q8ZB62|RS9_YERPE 30S ribosomal protein S9 OS=Yersinia pestis GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|B2K3Z6|RS9_YERPB 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|Q1C1G9|RS9_YERPA 30S ribosomal protein S9 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|A7FDX5|RS9_YERP3 30S ribosomal protein S9 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsI PE=3 SV=1 147 269 4.0E-23
sp|A8EXY2|RS9_RICCK 30S ribosomal protein S9 OS=Rickettsia canadensis (strain McKiel) GN=rpsI PE=3 SV=1 134 269 4.0E-23
sp|Q1AU64|RS9_RUBXD 30S ribosomal protein S9 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsI PE=3 SV=1 146 269 5.0E-23
sp|A2SKM0|RS9_METPP 30S ribosomal protein S9 OS=Methylibium petroleiphilum (strain PM1) GN=rpsI PE=3 SV=1 147 269 5.0E-23
sp|A4G1T3|RS9_HERAR 30S ribosomal protein S9 OS=Herminiimonas arsenicoxydans GN=rpsI PE=3 SV=1 147 269 5.0E-23
sp|B3PVW3|RS9_RHIE6 30S ribosomal protein S9 OS=Rhizobium etli (strain CIAT 652) GN=rpsI PE=3 SV=1 139 269 5.0E-23
sp|C3LS61|RS9_VIBCM 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsI PE=3 SV=1 147 269 6.0E-23
sp|Q9KUF0|RS9_VIBCH 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsI PE=3 SV=1 147 269 6.0E-23
sp|A5F998|RS9_VIBC3 30S ribosomal protein S9 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsI PE=3 SV=1 147 269 6.0E-23
sp|A1W3P8|RS9_ACISJ 30S ribosomal protein S9 OS=Acidovorax sp. (strain JS42) GN=rpsI PE=3 SV=1 147 269 6.0E-23
sp|B9MD53|RS9_ACIET 30S ribosomal protein S9 OS=Acidovorax ebreus (strain TPSY) GN=rpsI PE=3 SV=1 147 269 6.0E-23
sp|A9EYT5|RS9_SORC5 30S ribosomal protein S9 OS=Sorangium cellulosum (strain So ce56) GN=rpsI PE=3 SV=1 144 269 7.0E-23
sp|Q6FZQ5|RS9_BARQU 30S ribosomal protein S9 OS=Bartonella quintana (strain Toulouse) GN=rpsI PE=3 SV=1 139 269 7.0E-23
sp|Q64P28|RS9_BACFR 30S ribosomal protein S9 OS=Bacteroides fragilis (strain YCH46) GN=rpsI PE=3 SV=1 147 269 8.0E-23
sp|Q5L8W6|RS9_BACFN 30S ribosomal protein S9 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsI PE=3 SV=1 147 269 8.0E-23
sp|Q47VT2|RS9_COLP3 30S ribosomal protein S9 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsI PE=3 SV=1 147 269 8.0E-23
sp|C1D165|RS9_DEIDV 30S ribosomal protein S9 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsI PE=3 SV=1 147 269 8.0E-23
sp|B1VA58|RS9_PHYAS 30S ribosomal protein S9 OS=Phytoplasma australiense GN=rpsI PE=3 SV=1 146 269 9.0E-23
sp|A1JR92|RS9_YERE8 30S ribosomal protein S9 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsI PE=3 SV=1 147 269 1.0E-22
sp|A6L0V0|RS9_BACV8 30S ribosomal protein S9 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsI PE=3 SV=1 147 269 1.0E-22
sp|Q8YPK7|RS9_NOSS1 30S ribosomal protein S9 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsI PE=3 SV=1 143 269 1.0E-22
sp|Q3MF93|RS9_ANAVT 30S ribosomal protein S9 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsI PE=3 SV=1 143 269 1.0E-22
sp|B0TC92|RS9_HELMI 30S ribosomal protein S9 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsI PE=3 SV=1 146 269 1.0E-22
sp|A0PXY2|RS9_CLONN 30S ribosomal protein S9 OS=Clostridium novyi (strain NT) GN=rpsI PE=3 SV=1 147 269 1.0E-22
sp|B9JVC4|RS9_AGRVS 30S ribosomal protein S9 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsI PE=3 SV=1 139 269 1.0E-22
sp|A5FRV9|RS9_DEHMB 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpsI PE=3 SV=1 146 269 1.0E-22
sp|Q47LM6|RS9_THEFY 30S ribosomal protein S9 OS=Thermobifida fusca (strain YX) GN=rpsI PE=3 SV=1 112 269 1.0E-22
sp|A6LPU7|RS9_CLOB8 30S ribosomal protein S9 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsI PE=3 SV=1 146 269 1.0E-22
sp|Q8K9G0|RS9_BUCAP 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsI PE=3 SV=1 147 269 1.0E-22
sp|Q3Z949|RS9_DEHM1 30S ribosomal protein S9 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsI PE=3 SV=1 146 269 1.0E-22
sp|Q68XD4|RS9_RICTY 30S ribosomal protein S9 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsI PE=3 SV=1 126 269 2.0E-22
sp|A1TUF5|RS9_ACIAC 30S ribosomal protein S9 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|A6Q6P0|RS9_SULNB 30S ribosomal protein S9 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|B1KSI9|RS9_CLOBM 30S ribosomal protein S9 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|A7GJ38|RS9_CLOBL 30S ribosomal protein S9 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|B1IGB8|RS9_CLOBK 30S ribosomal protein S9 OS=Clostridium botulinum (strain Okra / Type B1) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|C1FMR5|RS9_CLOBJ 30S ribosomal protein S9 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|A5I7H0|RS9_CLOBH 30S ribosomal protein S9 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|C3KVL5|RS9_CLOB6 30S ribosomal protein S9 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|A7FZ37|RS9_CLOB1 30S ribosomal protein S9 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|Q9CNB1|RS9_PASMU 30S ribosomal protein S9 OS=Pasteurella multocida (strain Pm70) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|B2TIL1|RS9_CLOBB 30S ribosomal protein S9 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpsI PE=3 SV=1 146 269 2.0E-22
sp|B3EFY3|RS9_CHLL2 30S ribosomal protein S9 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsI PE=3 SV=1 149 269 2.0E-22
sp|P59514|RS9_BUCBP 30S ribosomal protein S9 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|A9C178|RS9_DELAS 30S ribosomal protein S9 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsI PE=3 SV=1 147 269 2.0E-22
sp|Q83AX9|RS9_COXBU 30S ribosomal protein S9 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsI PE=3 SV=1 146 269 3.0E-22
sp|A9NAB0|RS9_COXBR 30S ribosomal protein S9 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsI PE=3 SV=1 146 269 3.0E-22
sp|A9KBY1|RS9_COXBN 30S ribosomal protein S9 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsI PE=3 SV=1 146 269 3.0E-22
sp|B6J2V0|RS9_COXB2 30S ribosomal protein S9 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsI PE=3 SV=1 146 269 3.0E-22
sp|Q220T1|RS9_RHOFT 30S ribosomal protein S9 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsI PE=3 SV=1 147 269 3.0E-22
sp|Q2YBK3|RS9_NITMU 30S ribosomal protein S9 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpsI PE=3 SV=1 145 269 3.0E-22
sp|B2UYE6|RS9_CLOBA 30S ribosomal protein S9 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpsI PE=3 SV=1 146 269 4.0E-22
sp|A6SUN8|RS9_JANMA 30S ribosomal protein S9 OS=Janthinobacterium sp. (strain Marseille) GN=rpsI PE=3 SV=1 147 269 4.0E-22
sp|A8F8P5|RS9_PSELT 30S ribosomal protein S9 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsI PE=3 SV=1 149 269 4.0E-22
sp|Q890R7|RS9_CLOTE 30S ribosomal protein S9 OS=Clostridium tetani (strain Massachusetts / E88) GN=rpsI PE=3 SV=1 147 269 4.0E-22
sp|Q124N7|RS9_POLSJ 30S ribosomal protein S9 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsI PE=3 SV=1 147 269 4.0E-22
sp|A1VJJ4|RS9_POLNA 30S ribosomal protein S9 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsI PE=3 SV=1 147 269 4.0E-22
sp|A9VPB1|RS9_BACWK 30S ribosomal protein S9 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpsI PE=3 SV=1 147 269 4.0E-22
sp|Q9ZDU0|RS9_RICPR 30S ribosomal protein S9 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsI PE=3 SV=1 121 269 5.0E-22
sp|A1SF28|RS9_NOCSJ 30S ribosomal protein S9 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpsI PE=3 SV=1 145 269 5.0E-22
sp|B3EU85|RS9_AMOA5 30S ribosomal protein S9 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsI PE=3 SV=1 147 269 5.0E-22
sp|B2ITM7|RS9_NOSP7 30S ribosomal protein S9 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsI PE=3 SV=1 143 269 5.0E-22
sp|C4KZL2|RS9_EXISA 30S ribosomal protein S9 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsI PE=3 SV=1 144 269 5.0E-22
sp|B0T0S3|RS9_CAUSK 30S ribosomal protein S9 OS=Caulobacter sp. (strain K31) GN=rpsI PE=3 SV=1 128 269 6.0E-22
sp|C1B057|RS9_RHOOB 30S ribosomal protein S9 OS=Rhodococcus opacus (strain B4) GN=rpsI PE=3 SV=1 122 269 6.0E-22
sp|B1Y3K6|RS9_LEPCP 30S ribosomal protein S9 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsI PE=3 SV=1 147 269 6.0E-22
sp|B9K8D3|RS9_THENN 30S ribosomal protein S9 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsI PE=3 SV=1 147 269 6.0E-22
sp|Q63QW4|RS9_BURPS 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain K96243) GN=rpsI PE=3 SV=1 147 269 6.0E-22
sp|Q475T2|RS9_CUPPJ 30S ribosomal protein S9 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsI PE=3 SV=1 147 269 7.0E-22
sp|Q03EE9|RS9_PEDPA 30S ribosomal protein S9 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsI PE=3 SV=1 147 269 7.0E-22
sp|B1YH85|RS9_EXIS2 30S ribosomal protein S9 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsI PE=3 SV=1 144 269 7.0E-22
sp|Q87DD4|RS9_XYLFT 30S ribosomal protein S9 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsI PE=3 SV=1 147 269 7.0E-22
sp|B2IAE7|RS9_XYLF2 30S ribosomal protein S9 OS=Xylella fastidiosa (strain M23) GN=rpsI PE=3 SV=1 147 269 7.0E-22
sp|A1K970|RS9_AZOSB 30S ribosomal protein S9 OS=Azoarcus sp. (strain BH72) GN=rpsI PE=3 SV=1 147 269 8.0E-22
sp|A1WL75|RS9_VEREI 30S ribosomal protein S9 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsI PE=3 SV=1 147 269 8.0E-22
sp|A3NDG7|RS9_BURP6 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 668) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q3JNR2|RS9_BURP1 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A3NZ79|RS9_BURP0 30S ribosomal protein S9 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A1V052|RS9_BURMS 30S ribosomal protein S9 OS=Burkholderia mallei (strain SAVP1) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q62HB9|RS9_BURMA 30S ribosomal protein S9 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A2S582|RS9_BURM9 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A3MP60|RS9_BURM7 30S ribosomal protein S9 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q81VP8|RS9_BACAN 30S ribosomal protein S9 OS=Bacillus anthracis GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|C3LJX8|RS9_BACAC 30S ribosomal protein S9 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|C3PAK4|RS9_BACAA 30S ribosomal protein S9 OS=Bacillus anthracis (strain A0248) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A7GK54|RS9_BACCN 30S ribosomal protein S9 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q1LRC9|RS9_CUPMC 30S ribosomal protein S9 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|B8DPL8|RS9_DESVM 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|B4UBJ2|RS9_ANASK 30S ribosomal protein S9 OS=Anaeromyxobacter sp. (strain K) GN=rpsI PE=3 SV=1 146 269 1.0E-21
sp|Q2IEX8|RS9_ANADE 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsI PE=3 SV=1 146 269 1.0E-21
sp|B8J5I5|RS9_ANAD2 30S ribosomal protein S9 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsI PE=3 SV=1 146 269 1.0E-21
sp|B8DB44|RS9_LISMH 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q71WI2|RS9_LISMF 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|C1KZ11|RS9_LISMC 30S ribosomal protein S9 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q927P3|RS9_LISIN 30S ribosomal protein S9 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A1WYS8|RS9_HALHL 30S ribosomal protein S9 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|A9AH80|RS9_BURM1 30S ribosomal protein S9 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q0KED8|RS9_CUPNH 30S ribosomal protein S9 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsI PE=3 SV=1 147 269 1.0E-21
sp|Q38UV5|RS9_LACSS 30S ribosomal protein S9 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B6J4Q5|RS9_COXB1 30S ribosomal protein S9 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsI PE=3 SV=1 146 269 2.0E-21
sp|B8I816|RS9_CLOCE 30S ribosomal protein S9 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q8A0Z5|RS9_BACTN 30S ribosomal protein S9 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B2AH58|RS9_CUPTR 30S ribosomal protein S9 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q6HPM5|RS9_BACHK 30S ribosomal protein S9 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q63H57|RS9_BACCZ 30S ribosomal protein S9 OS=Bacillus cereus (strain ZK / E33L) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q81J12|RS9_BACCR 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B9IZM8|RS9_BACCQ 30S ribosomal protein S9 OS=Bacillus cereus (strain Q1) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B7HQX8|RS9_BACC7 30S ribosomal protein S9 OS=Bacillus cereus (strain AH187) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B7HJJ1|RS9_BACC4 30S ribosomal protein S9 OS=Bacillus cereus (strain B4264) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|C1ET73|RS9_BACC3 30S ribosomal protein S9 OS=Bacillus cereus (strain 03BB102) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B7IT53|RS9_BACC2 30S ribosomal protein S9 OS=Bacillus cereus (strain G9842) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q73F62|RS9_BACC1 30S ribosomal protein S9 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|B7JKF4|RS9_BACC0 30S ribosomal protein S9 OS=Bacillus cereus (strain AH820) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|A0R8L3|RS9_BACAH 30S ribosomal protein S9 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|A6TWE6|RS9_ALKMQ 30S ribosomal protein S9 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q1LU53|RS9_BAUCH 30S ribosomal protein S9 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|Q1WSC3|RS9_LACS1 30S ribosomal protein S9 OS=Lactobacillus salivarius (strain UCC118) GN=rpsI PE=3 SV=1 147 269 2.0E-21
sp|A0T0K2|RR9_PHATC 30S ribosomal protein S9, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps9 PE=3 SV=1 131 269 3.0E-21
sp|A0ALT2|RS9_LISW6 30S ribosomal protein S9 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsI PE=3 SV=1 147 269 3.0E-21
sp|B2UFK2|RS9_RALPJ 30S ribosomal protein S9 OS=Ralstonia pickettii (strain 12J) GN=rpsI PE=3 SV=1 147 269 3.0E-21
sp|C5CDI2|RS9_KOSOT 30S ribosomal protein S9 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsI PE=3 SV=1 146 269 3.0E-21
sp|Q2SZ68|RS9_BURTA 30S ribosomal protein S9 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsI PE=3 SV=1 147 269 3.0E-21
sp|Q9RXY0|RS9_DEIRA 30S ribosomal protein S9 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|Q2S9X3|RS9_HAHCH 30S ribosomal protein S9 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|A4JBK5|RS9_BURVG 30S ribosomal protein S9 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|Q18CJ5|RS9_PEPD6 30S ribosomal protein S9 OS=Peptoclostridium difficile (strain 630) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|Q39JJ9|RS9_BURL3 30S ribosomal protein S9 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|B4EET5|RS9_BURCJ 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|A0K4K6|RS9_BURCH 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|B1JVU5|RS9_BURCC 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|Q1BZ44|RS9_BURCA 30S ribosomal protein S9 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|A6LHM6|RS9_PARD8 30S ribosomal protein S9 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsI PE=3 SV=1 147 269 4.0E-21
sp|Q8RGG8|RS9_FUSNN 30S ribosomal protein S9 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsI PE=3 SV=1 140 269 4.0E-21
sp|B2JGV1|RS9_BURP8 30S ribosomal protein S9 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsI PE=3 SV=1 147 269 5.0E-21
sp|Q03PZ0|RS9_LACBA 30S ribosomal protein S9 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsI PE=3 SV=1 147 269 5.0E-21
sp|B1HMU8|RS9_LYSSC 30S ribosomal protein S9 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsI PE=3 SV=1 146 269 5.0E-21
sp|Q02VM1|RS9_LACLS 30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsI PE=3 SV=1 147 269 6.0E-21
sp|A2RP61|RS9_LACLM 30S ribosomal protein S9 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsI PE=3 SV=1 147 269 6.0E-21
sp|Q9CDG7|RS9_LACLA 30S ribosomal protein S9 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsI PE=3 SV=1 147 269 6.0E-21
sp|P31177|RS9_STACT 30S ribosomal protein S9 OS=Staphylococcus carnosus (strain TM300) GN=rpsI PE=3 SV=2 147 269 7.0E-21
sp|A1BHZ6|RS9_CHLPD 30S ribosomal protein S9 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsI PE=3 SV=1 149 269 8.0E-21
sp|Q9HVY3|RS9_PSEAE 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsI PE=3 SV=1 147 269 9.0E-21
sp|Q02H08|RS9_PSEAB 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsI PE=3 SV=1 147 269 9.0E-21
sp|B7UZL0|RS9_PSEA8 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsI PE=3 SV=1 147 269 9.0E-21
sp|Q0A6F4|RS9_ALKEH 30S ribosomal protein S9 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsI PE=3 SV=1 147 269 9.0E-21
sp|Q0BI90|RS9_BURCM 30S ribosomal protein S9 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|B1YTD2|RS9_BURA4 30S ribosomal protein S9 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|B0U6Z5|RS9_XYLFM 30S ribosomal protein S9 OS=Xylella fastidiosa (strain M12) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|O67723|RS9_AQUAE 30S ribosomal protein S9 OS=Aquifex aeolicus (strain VF5) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|Q6YR77|RS9_ONYPE 30S ribosomal protein S9 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|B1LBJ1|RS9_THESQ 30S ribosomal protein S9 OS=Thermotoga sp. (strain RQ2) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|Q9X1G4|RS9_THEMA 30S ribosomal protein S9 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|Q8Y245|RS9_RALSO 30S ribosomal protein S9 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|Q7MX42|RS9_PORGI 30S ribosomal protein S9 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|B2RL63|RS9_PORG3 30S ribosomal protein S9 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|Q2NIP5|RS9_AYWBP 30S ribosomal protein S9 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsI PE=3 SV=1 147 269 1.0E-20
sp|Q9KGD4|RS9_BACHD 30S ribosomal protein S9 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|Q20F01|RR9_OLTVI 30S ribosomal protein S9, chloroplastic OS=Oltmannsiellopsis viridis GN=rps9 PE=3 SV=1 146 269 2.0E-20
sp|Q88XU7|RS9_LACPL 30S ribosomal protein S9 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|Q11QN5|RS9_CYTH3 30S ribosomal protein S9 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|B0JY34|RS9_MICAN 30S ribosomal protein S9 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|Q8Y459|RS9_LISMO 30S ribosomal protein S9 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|C5D3V1|RS9_GEOSW 30S ribosomal protein S9 OS=Geobacillus sp. (strain WCH70) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|B1XJI0|RS9_SYNP2 30S ribosomal protein S9 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|B6YQS6|RS9_AZOPC 30S ribosomal protein S9 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsI PE=3 SV=1 147 269 2.0E-20
sp|A6VBA5|RS9_PSEA7 30S ribosomal protein S9 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsI PE=3 SV=1 147 269 3.0E-20
sp|Q13UB3|RS9_BURXL 30S ribosomal protein S9 OS=Burkholderia xenovorans (strain LB400) GN=rpsI PE=3 SV=1 147 269 3.0E-20
sp|B2SYK9|RS9_BURPP 30S ribosomal protein S9 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsI PE=3 SV=1 147 269 3.0E-20
sp|Q0SNH4|RS9_BORAP 30S ribosomal protein S9 OS=Borrelia afzelii (strain PKo) GN=rpsI PE=3 SV=1 145 269 3.0E-20
sp|A5IMD2|RS9_THEP1 30S ribosomal protein S9 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsI PE=3 SV=1 147 269 4.0E-20
sp|B7J1R3|RS9_BORBZ 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ZS7) GN=rpsI PE=3 SV=1 145 269 4.0E-20
sp|O51313|RS9_BORBU 30S ribosomal protein S9 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsI PE=3 SV=1 145 269 4.0E-20
sp|C6C1K0|RS9_DESAD 30S ribosomal protein S9 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsI PE=3 SV=1 147 269 4.0E-20
sp|Q054G7|RS9_LEPBL 30S ribosomal protein S9 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsI PE=3 SV=1 147 269 4.0E-20
sp|Q04QG5|RS9_LEPBJ 30S ribosomal protein S9 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsI PE=3 SV=1 147 269 4.0E-20
sp|Q7NRT4|RS9_CHRVO 30S ribosomal protein S9 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsI PE=3 SV=1 147 269 4.0E-20
sp|Q661S9|RS9_BORBP 30S ribosomal protein S9 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsI PE=3 SV=1 145 269 5.0E-20
sp|A1VBD2|RS9_DESVV 30S ribosomal protein S9 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsI PE=3 SV=1 147 269 5.0E-20
sp|Q728T3|RS9_DESVH 30S ribosomal protein S9 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsI PE=3 SV=1 147 269 5.0E-20
sp|A1ATL0|RS9_PELPD 30S ribosomal protein S9 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsI PE=3 SV=1 147 269 5.0E-20
sp|A5N4T2|RS9_CLOK5 30S ribosomal protein S9 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsI PE=3 SV=1 147 269 5.0E-20
sp|B9DYE4|RS9_CLOK1 30S ribosomal protein S9 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsI PE=3 SV=1 147 269 5.0E-20
sp|Q0AHZ9|RS9_NITEC 30S ribosomal protein S9 OS=Nitrosomonas eutropha (strain C91) GN=rpsI PE=3 SV=1 147 269 6.0E-20
sp|P51291|RR9_PORPU 30S ribosomal protein S9, chloroplastic OS=Porphyra purpurea GN=rps9 PE=3 SV=1 147 269 6.0E-20
sp|Q49ZD5|RS9_STAS1 30S ribosomal protein S9 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsI PE=3 SV=1 147 269 6.0E-20
sp|Q1XDJ7|RR9_PYRYE 30S ribosomal protein S9, chloroplastic OS=Pyropia yezoensis GN=rps9 PE=3 SV=1 147 269 7.0E-20
sp|Q82Z47|RS9_ENTFA 30S ribosomal protein S9 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsI PE=3 SV=1 147 269 7.0E-20
sp|B3QLF6|RS9_CHLP8 30S ribosomal protein S9 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsI PE=3 SV=1 149 252 8.0E-20
sp|Q8NST5|RS9_CORGL 30S ribosomal protein S9 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rpsI PE=3 SV=1 137 269 8.0E-20
sp|A4QBS4|RS9_CORGB 30S ribosomal protein S9 OS=Corynebacterium glutamicum (strain R) GN=rpsI PE=3 SV=1 137 269 8.0E-20
sp|Q9PPR3|RS9_UREPA 30S ribosomal protein S9 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsI PE=3 SV=1 149 269 8.0E-20
sp|B1AJL7|RS9_UREP2 30S ribosomal protein S9 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsI PE=3 SV=1 149 269 8.0E-20
sp|Q8ETV3|RS9_OCEIH 30S ribosomal protein S9 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsI PE=3 SV=1 147 269 8.0E-20
sp|A0LXM9|RS9_GRAFK 30S ribosomal protein S9 OS=Gramella forsetii (strain KT0803) GN=rpsI PE=3 SV=1 149 269 1.0E-19
sp|Q3B5U1|RS9_CHLL7 30S ribosomal protein S9 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsI PE=3 SV=1 149 269 1.0E-19
sp|Q9MUV1|RR9_MESVI 30S ribosomal protein S9, chloroplastic OS=Mesostigma viride GN=rps9 PE=3 SV=1 146 269 1.0E-19
sp|B2FJU3|RS9_STRMK 30S ribosomal protein S9 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsI PE=3 SV=1 147 269 1.0E-19
sp|B4SLE0|RS9_STRM5 30S ribosomal protein S9 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsI PE=3 SV=1 147 269 1.0E-19
sp|Q82UK1|RS9_NITEU 30S ribosomal protein S9 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsI PE=3 SV=1 147 269 1.0E-19
sp|B5ZC90|RS9_UREU1 30S ribosomal protein S9 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsI PE=3 SV=1 149 269 1.0E-19
sp|Q9PD43|RS9_XYLFA 30S ribosomal protein S9 OS=Xylella fastidiosa (strain 9a5c) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|B0C426|RS9_ACAM1 30S ribosomal protein S9 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|B9M6W3|RS9_GEODF 30S ribosomal protein S9 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|A8MLH6|RS9_ALKOO 30S ribosomal protein S9 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|Q8PD66|RS9_XANCP 30S ribosomal protein S9 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|B0RN06|RS9_XANCB 30S ribosomal protein S9 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|Q4UZF1|RS9_XANC8 30S ribosomal protein S9 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsI PE=3 SV=1 147 269 2.0E-19
sp|Q97EL3|RS9_CLOAB 30S ribosomal protein S9 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsI PE=3 SV=1 146 269 2.0E-19
sp|Q1MQW3|RS9_LAWIP 30S ribosomal protein S9 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsI PE=3 SV=1 147 269 3.0E-19
sp|B8HNG6|RS9_CYAP4 30S ribosomal protein S9 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsI PE=3 SV=1 146 269 3.0E-19
sp|Q3BYA8|RS9_XANC5 30S ribosomal protein S9 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsI PE=3 SV=1 147 269 3.0E-19
sp|Q8PQ41|RS9_XANAC 30S ribosomal protein S9 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsI PE=3 SV=1 147 269 3.0E-19
sp|Q6ANL9|RS9_DESPS 30S ribosomal protein S9 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsI PE=3 SV=1 137 269 3.0E-19
sp|Q5WLM8|RS9_BACSK 30S ribosomal protein S9 OS=Bacillus clausii (strain KSM-K16) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|Q4L880|RS9_STAHJ 30S ribosomal protein S9 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|Q5GV67|RS9_XANOR 30S ribosomal protein S9 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B2SL10|RS9_XANOP 30S ribosomal protein S9 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|Q2NYE4|RS9_XANOM 30S ribosomal protein S9 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|P9WH25|RS9_MYCTU 30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsI PE=1 SV=1 149 269 4.0E-19
sp|P9WH24|RS9_MYCTO 30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsI PE=3 SV=1 149 269 4.0E-19
sp|A5U8B8|RS9_MYCTA 30S ribosomal protein S9 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsI PE=3 SV=1 149 269 4.0E-19
sp|C1AHQ1|RS9_MYCBT 30S ribosomal protein S9 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsI PE=3 SV=1 149 269 4.0E-19
sp|A1KPC9|RS9_MYCBP 30S ribosomal protein S9 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsI PE=3 SV=1 149 269 4.0E-19
sp|P66640|RS9_MYCBO 30S ribosomal protein S9 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsI PE=3 SV=1 149 269 4.0E-19
sp|C1CC86|RS9_STRZJ 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain JJA) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|Q8CWU4|RS9_STRR6 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B2ISM4|RS9_STRPS 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B1I922|RS9_STRPI 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|C1CB69|RS9_STRP7 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain 70585) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B5E6W9|RS9_STRP4 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|Q04MF5|RS9_STRP2 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B9E9M4|RS9_MACCJ 30S ribosomal protein S9 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|C1CPG8|RS9_STRZT 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|C1CIH6|RS9_STRZP 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain P1031) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|Q97SN4|RS9_STRPN 30S ribosomal protein S9 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B8ZL30|RS9_STRPJ 30S ribosomal protein S9 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsI PE=3 SV=1 147 269 4.0E-19
sp|B3WAH9|RS9_LACCB 30S ribosomal protein S9 OS=Lactobacillus casei (strain BL23) GN=rpsI PE=3 SV=1 147 269 5.0E-19
sp|Q035C4|RS9_LACC3 30S ribosomal protein S9 OS=Lactobacillus casei (strain ATCC 334) GN=rpsI PE=3 SV=1 147 269 5.0E-19
sp|Q7VQR6|RS9_BLOFL 30S ribosomal protein S9 OS=Blochmannia floridanus GN=rpsI PE=3 SV=1 147 269 5.0E-19
sp|B7GJ32|RS9_ANOFW 30S ribosomal protein S9 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsI PE=3 SV=1 147 269 5.0E-19
sp|Q30Y42|RS9_DESAG 30S ribosomal protein S9 OS=Desulfovibrio alaskensis (strain G20) GN=rpsI PE=3 SV=1 147 269 6.0E-19
sp|Q3A3B7|RS9_PELCD 30S ribosomal protein S9 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsI PE=3 SV=1 144 269 7.0E-19
sp|Q82DL8|RS9_STRAW 30S ribosomal protein S9 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsI PE=3 SV=1 136 269 7.0E-19
sp|Q8CRJ0|RS9_STAES 30S ribosomal protein S9 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsI PE=3 SV=1 147 269 7.0E-19
sp|Q5HM32|RS9_STAEQ 30S ribosomal protein S9 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsI PE=3 SV=1 147 269 7.0E-19
sp|Q53875|RS9_STRCO 30S ribosomal protein S9 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsI PE=3 SV=1 145 269 8.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3475
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1844 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7371
Ophiocordyceps camponoti-floridani Ophcf2|04800
Ophiocordyceps camponoti-rufipedis Ophun1|58
Ophiocordyceps kimflemingae Ophio5|5367
Ophiocordyceps subramaniannii Hirsu2|6636

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1844
MRQMSQETLAVPVPDDSSIEIPFQGISIARSVPVSPSYFSRETRFNDLFVKFSKLLARYHHLPTVTVAKAPQVPW
MKLQLLRVRLGEPIKAAQFAKFRRIAKRLNLIEPSLMPAEVTAAIKEVLRDINPFLNRPRQLVLDKFGRAVATGK
RKESTARAFVVEGTGEVLINGKPLHQAFGRVHDRESAIWALMATQRLDKYNVWALVRGGGTTGQAEALALAVAKA
LVVHEPDLKPALRRAGCITRDPRTVERKKTGHVKARKMPAWRKR*
Coding >OphauG2|1844
ATGCGTCAGATGTCACAGGAAACATTGGCCGTGCCTGTTCCCGACGATAGTTCCATCGAAATCCCCTTTCAAGGC
ATCTCTATCGCGCGCTCCGTACCGGTCTCGCCCTCGTACTTTTCGCGAGAAACAAGATTCAATGACCTCTTTGTC
AAATTCTCCAAGCTTCTGGCCAGATATCACCATCTGCCCACTGTTACCGTGGCCAAGGCGCCTCAAGTGCCATGG
ATGAAGCTGCAACTACTGCGTGTGCGCCTGGGAGAGCCCATCAAGGCTGCACAGTTTGCCAAATTTAGACGCATA
GCCAAAAGACTCAATCTCATCGAGCCGTCGTTGATGCCAGCAGAAGTCACGGCTGCAATTAAAGAAGTTTTACGA
GACATTAATCCTTTCCTCAATCGACCCAGGCAGCTGGTCCTGGACAAATTTGGGCGTGCAGTAGCCACGGGCAAA
AGGAAGGAATCGACGGCCCGAGCATTTGTTGTTGAAGGTACAGGAGAAGTACTGATCAATGGCAAACCACTGCAC
CAAGCTTTTGGCCGAGTACACGACCGTGAAAGCGCCATATGGGCGCTCATGGCTACCCAAAGACTGGACAAGTAC
AATGTCTGGGCATTGGTGCGTGGAGGCGGAACGACTGGGCAGGCAGAGGCTCTTGCGCTGGCCGTGGCAAAGGCC
CTCGTCGTGCATGAGCCGGATTTGAAGCCAGCGCTGAGACGAGCTGGCTGTATTACGAGGGATCCCAGAACGGTC
GAGAGGAAGAAGACTGGCCACGTCAAAGCCCGCAAGATGCCAGCGTGGAGGAAGCGATAG
Transcript >OphauG2|1844
ATGCGTCAGATGTCACAGGAAACATTGGCCGTGCCTGTTCCCGACGATAGTTCCATCGAAATCCCCTTTCAAGGC
ATCTCTATCGCGCGCTCCGTACCGGTCTCGCCCTCGTACTTTTCGCGAGAAACAAGATTCAATGACCTCTTTGTC
AAATTCTCCAAGCTTCTGGCCAGATATCACCATCTGCCCACTGTTACCGTGGCCAAGGCGCCTCAAGTGCCATGG
ATGAAGCTGCAACTACTGCGTGTGCGCCTGGGAGAGCCCATCAAGGCTGCACAGTTTGCCAAATTTAGACGCATA
GCCAAAAGACTCAATCTCATCGAGCCGTCGTTGATGCCAGCAGAAGTCACGGCTGCAATTAAAGAAGTTTTACGA
GACATTAATCCTTTCCTCAATCGACCCAGGCAGCTGGTCCTGGACAAATTTGGGCGTGCAGTAGCCACGGGCAAA
AGGAAGGAATCGACGGCCCGAGCATTTGTTGTTGAAGGTACAGGAGAAGTACTGATCAATGGCAAACCACTGCAC
CAAGCTTTTGGCCGAGTACACGACCGTGAAAGCGCCATATGGGCGCTCATGGCTACCCAAAGACTGGACAAGTAC
AATGTCTGGGCATTGGTGCGTGGAGGCGGAACGACTGGGCAGGCAGAGGCTCTTGCGCTGGCCGTGGCAAAGGCC
CTCGTCGTGCATGAGCCGGATTTGAAGCCAGCGCTGAGACGAGCTGGCTGTATTACGAGGGATCCCAGAACGGTC
GAGAGGAAGAAGACTGGCCACGTCAAAGCCCGCAAGATGCCAGCGTGGAGGAAGCGATAG
Gene >OphauG2|1844
ATGCGTCAGATGTCACAGGAAACATTGGCCGTGCCTGTTCCCGACGATAGTTCCATCGAAATCCCCTTTCAAGGC
ATCTCTATCGCGCGCTCCGTACCGGTCTCGCCCTCGTACTTTTCGCGAGAAACAAGATTCAATGACCTCTTTGTC
AAATTCTCCAAGCTTCTGGCCAGATATCACCATCTGCCCACTGTTACCGTGGCCAAGGCGCCTCAAGTGCCATGG
ATGAAGCTGCAACTACTGCGTGTGCGCCTGGGAGAGCCCATCAAGGCTGCACAGTTTGCCAAATTTAGACGCATA
GCCAAAAGACTCAATCTCATCGAGCCGTCGTTGATGCCAGCAGAAGTCACGGCTGCAATTAAAGAAGTTTTACGA
GACATTAATCCTTTCCTCAATCGACCCAGGCAGCTGGTCCTGGACAAATTTGGGCGTGCAGTAGCCACGGGCAAA
AGGAAGGAATCGACGGCCCGAGCATTTGTTGTTGAAGGTACAGGAGAAGTACTGATCAATGGCAAACCACTGCAC
CAAGCTTTTGGCCGAGTACACGACCGTGAAAGCGCCATATGGGCGCTCATGGCTACCCAAAGACTGGACAAGTAC
AATGTCTGGGCATTGGTGCGTGGAGGCGGAACGACTGGGCAGGCAGAGGCTCTTGCGCTGGCCGTGGCAAAGGCC
CTCGTCGTGCATGAGCCGGATTTGAAGCCAGCGCTGAGACGAGGTAAGGACCATGGTTGATGAGTGCTGTATGCA
TGCCATTTCAAAATGCTAATCGGCTGCTACCTGTTCAGCTGGCTGTATTACGAGGGATCCCAGAACGGTCGAGAG
GAAGAAGACTGGCCACGTCAAAGCCCGCAAGATGCCAGCGTGGAGGAAGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail