Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|184
Gene name
LocationContig_1030:3970..5228
Strand+
Gene length (bp)1258
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08242 Methyltransf_12 Methyltransferase domain 1.0E-13 156 258
PF13649 Methyltransf_25 Methyltransferase domain 5.2E-13 155 257
PF08241 Methyltransf_11 Methyltransferase domain 1.6E-10 156 261
PF13489 Methyltransf_23 Methyltransferase domain 1.0E-10 142 307
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.7E-04 149 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3 51 351 9.0E-107
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 59 353 1.0E-106
sp|Q86BS6|METL_DROME Methyltransferase-like protein OS=Drosophila melanogaster GN=metl PE=1 SV=2 52 353 3.0E-77
sp|A8KBL7|MEL2A_DANRE Methyltransferase-like protein 2-A OS=Danio rerio GN=mettl2a PE=2 SV=1 58 353 3.0E-76
sp|Q5M8E6|METL2_XENTR Methyltransferase-like protein 2 OS=Xenopus tropicalis GN=mettl2 PE=2 SV=1 58 353 4.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3 51 351 9.0E-107
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 59 353 1.0E-106
sp|Q86BS6|METL_DROME Methyltransferase-like protein OS=Drosophila melanogaster GN=metl PE=1 SV=2 52 353 3.0E-77
sp|A8KBL7|MEL2A_DANRE Methyltransferase-like protein 2-A OS=Danio rerio GN=mettl2a PE=2 SV=1 58 353 3.0E-76
sp|Q5M8E6|METL2_XENTR Methyltransferase-like protein 2 OS=Xenopus tropicalis GN=mettl2 PE=2 SV=1 58 353 4.0E-69
sp|Q8BMK1|METL2_MOUSE Methyltransferase-like protein 2 OS=Mus musculus GN=Mettl2 PE=2 SV=2 58 353 5.0E-69
sp|Q6P1Q9|MET2B_HUMAN Methyltransferase-like protein 2B OS=Homo sapiens GN=METTL2B PE=1 SV=3 58 353 6.0E-64
sp|Q96IZ6|MET2A_HUMAN Methyltransferase-like protein 2A OS=Homo sapiens GN=METTL2A PE=1 SV=5 58 353 3.0E-63
sp|Q0P5B2|METL2_BOVIN Methyltransferase-like protein 2 OS=Bos taurus GN=METTL2 PE=2 SV=1 155 353 7.0E-58
sp|Q5ZHP8|METL2_CHICK Methyltransferase-like protein 2 OS=Gallus gallus GN=METTL2 PE=2 SV=1 155 353 1.0E-54
sp|Q8TCB7|METL6_HUMAN Methyltransferase-like protein 6 OS=Homo sapiens GN=METTL6 PE=2 SV=2 89 353 2.0E-48
sp|Q5RDV8|METL6_PONAB Methyltransferase-like protein 6 OS=Pongo abelii GN=METTL6 PE=2 SV=1 89 353 3.0E-48
sp|Q6AXU8|METL6_RAT Methyltransferase-like protein 6 OS=Rattus norvegicus GN=Mettl6 PE=2 SV=1 98 353 8.0E-48
sp|Q8BVH9|METL6_MOUSE Methyltransferase-like protein 6 OS=Mus musculus GN=Mettl6 PE=2 SV=2 98 353 8.0E-48
sp|Q8T199|OMT3_DICDI O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt3 PE=2 SV=1 118 353 6.0E-41
sp|O74386|YNVB_SCHPO Uncharacterized methyltransferase C3H7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.11 PE=3 SV=1 117 353 6.0E-36
sp|A2AUU0|METL8_MOUSE Methyltransferase-like protein 8 OS=Mus musculus GN=Mettl8 PE=1 SV=2 59 165 1.0E-13
sp|Q9H825|METL8_HUMAN Methyltransferase-like protein 8 OS=Homo sapiens GN=METTL8 PE=2 SV=2 155 239 2.0E-10
sp|Q9H825|METL8_HUMAN Methyltransferase-like protein 8 OS=Homo sapiens GN=METTL8 PE=2 SV=2 59 148 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|184
MGSAASEARDLDSASPLPPTEQLAALQMASHDYETATAVPPHLSHDPANNLKRSDPFQFGSRFLTETDDVFEFNA
WDHVETDDAYKEYAERQFEMQRQAPVSEFDKNRFNANPEKWWNLFYKNNASNFFKNRKWLQQEFPILAEVTKEDA
GPVTVLEIGAGAGNTAFPVLANNKNAQLKIHACDFSKTAVEVMRANEAYDPKFIQAHVWDAAGESLPPGLGEASV
DVAVMVFIFSALSPMEWAQAVSNVYQLLKPGGLVCFRDYGRGDLAQVRFRKGRYLQENFYIRGDGTRVYFFDKDE
LADIWSGKKFETEMGVEAPRFEVENLGIDRRLLINRAQKIKMYRCWIQGRFRKR*
Coding >OphauG2|184
ATGGGGTCAGCAGCATCAGAAGCCCGTGATTTGGACTCAGCATCTCCATTGCCGCCAACGGAGCAGCTGGCAGCA
CTCCAAATGGCGAGCCATGACTATGAGACTGCTACCGCTGTGCCACCGCATCTCTCGCATGATCCGGCTAATAAT
CTCAAGCGCAGCGATCCCTTTCAGTTTGGCAGCCGATTTCTCACAGAGACTGATGACGTGTTCGAATTCAATGCC
TGGGACCACGTCGAGACTGACGACGCGTATAAGGAATATGCTGAGCGCCAGTTTGAGATGCAACGTCAGGCACCA
GTCTCAGAGTTTGATAAGAACAGGTTCAACGCGAACCCGGAAAAATGGTGGAATCTATTCTATAAGAATAATGCC
TCCAACTTCTTCAAGAATCGCAAGTGGTTGCAGCAAGAGTTTCCTATTTTGGCCGAGGTGACAAAGGAAGATGCT
GGCCCAGTGACAGTACTTGAAATTGGCGCTGGCGCCGGCAACACTGCGTTTCCTGTCCTTGCCAACAACAAGAAT
GCGCAGCTCAAAATCCACGCCTGCGACTTCTCCAAGACGGCCGTCGAAGTGATGCGTGCCAATGAGGCATATGAC
CCCAAGTTTATACAAGCCCATGTCTGGGACGCCGCGGGCGAAAGCCTACCCCCAGGTCTTGGCGAAGCATCCGTA
GACGTGGCTGTCATGGTCTTCATCTTCTCGGCGCTGTCGCCCATGGAGTGGGCGCAGGCAGTGAGCAATGTGTAC
CAGTTGCTTAAGCCTGGCGGCCTAGTCTGCTTCCGTGACTATGGAAGAGGAGACTTGGCACAGGTCCGGTTTCGC
AAGGGCCGGTATCTGCAAGAAAACTTTTATATTCGCGGTGACGGCACCCGCGTCTACTTTTTTGACAAGGATGAA
CTGGCTGATATATGGTCGGGGAAGAAATTTGAGACTGAAATGGGAGTCGAGGCACCAAGGTTCGAGGTTGAGAAC
CTTGGTATTGACCGGCGACTGCTCATTAACCGAGCACAAAAGATTAAAATGTATCGCTGTTGGATTCAGGGTCGC
TTTAGAAAAAGATGA
Transcript >OphauG2|184
ATGGGGTCAGCAGCATCAGAAGCCCGTGATTTGGACTCAGCATCTCCATTGCCGCCAACGGAGCAGCTGGCAGCA
CTCCAAATGGCGAGCCATGACTATGAGACTGCTACCGCTGTGCCACCGCATCTCTCGCATGATCCGGCTAATAAT
CTCAAGCGCAGCGATCCCTTTCAGTTTGGCAGCCGATTTCTCACAGAGACTGATGACGTGTTCGAATTCAATGCC
TGGGACCACGTCGAGACTGACGACGCGTATAAGGAATATGCTGAGCGCCAGTTTGAGATGCAACGTCAGGCACCA
GTCTCAGAGTTTGATAAGAACAGGTTCAACGCGAACCCGGAAAAATGGTGGAATCTATTCTATAAGAATAATGCC
TCCAACTTCTTCAAGAATCGCAAGTGGTTGCAGCAAGAGTTTCCTATTTTGGCCGAGGTGACAAAGGAAGATGCT
GGCCCAGTGACAGTACTTGAAATTGGCGCTGGCGCCGGCAACACTGCGTTTCCTGTCCTTGCCAACAACAAGAAT
GCGCAGCTCAAAATCCACGCCTGCGACTTCTCCAAGACGGCCGTCGAAGTGATGCGTGCCAATGAGGCATATGAC
CCCAAGTTTATACAAGCCCATGTCTGGGACGCCGCGGGCGAAAGCCTACCCCCAGGTCTTGGCGAAGCATCCGTA
GACGTGGCTGTCATGGTCTTCATCTTCTCGGCGCTGTCGCCCATGGAGTGGGCGCAGGCAGTGAGCAATGTGTAC
CAGTTGCTTAAGCCTGGCGGCCTAGTCTGCTTCCGTGACTATGGAAGAGGAGACTTGGCACAGGTCCGGTTTCGC
AAGGGCCGGTATCTGCAAGAAAACTTTTATATTCGCGGTGACGGCACCCGCGTCTACTTTTTTGACAAGGATGAA
CTGGCTGATATATGGTCGGGGAAGAAATTTGAGACTGAAATGGGAGTCGAGGCACCAAGGTTCGAGGTTGAGAAC
CTTGGTATTGACCGGCGACTGCTCATTAACCGAGCACAAAAGATTAAAATGTATCGCTGTTGGATTCAGGGTCGC
TTTAGAAAAAGATGA
Gene >OphauG2|184
ATGGGGTCAGCAGCATCAGAAGCCCGTGATTTGGACTCAGCATCTCCATTGCCGCCAACGGAGCAGCTGGCAGCA
CTCCAAATGGCGAGCCATGACTATGAGACTGCTACCGCTGTGCCACCGCATCTCTCGCATGATCCGGCTAATAAT
CTCAAGCGCAGCGATCCCTTTCAGTTTGGCAGCCGATTTCTCACAGAGACTGATGACGTGTTCGAATTCAATGCC
TGGGACCACGTCGAGACTGACGACGCGTATAAGGAATATGCTGAGCGCCAGTTTGAGATGCAACGTCAGGCACCA
GTCTCAGAGTTTGATAAGAGTATGTTTCTTCTTTTAGGGCCTGCCTTTCAATACCGTGTTGTGATGATACAATTT
CCAATGCATAGTTCATCTGATTCTGATGACGATAACTATACCTTCACCTAGTCTTTCGCTCCCATCTGAACGCAT
GTTTTTATTATTGCTGCATCATGACTCTCTGTAAGCTCTAATGCTGACTTGGTGGAATTAAGACAGGTTCAACGC
GAACCCGGAAAAATGGTGGAATCTATTCTATAAGAATAATGCCTCCAACTTCTTCAAGAATCGCAAGTGGTTGCA
GCAAGAGTTTCCTATTTTGGCCGAGGTGACAAAGGAAGATGCTGGCCCAGTGACAGTACTTGAAATTGGCGCTGG
CGCCGGCAACACTGCGTTTCCTGTCCTTGCCAACAACAAGAATGCGCAGCTCAAAATCCACGCCTGCGACTTCTC
CAAGACGGCCGTCGAAGTGATGCGTGCCAATGAGGCATATGACCCCAAGTTTATACAAGCCCATGTCTGGGACGC
CGCGGGCGAAAGCCTACCCCCAGGTCTTGGCGAAGCATCCGTAGACGTGGCTGTCATGGTCTTCATCTTCTCGGC
GCTGTCGCCCATGGAGTGGGCGCAGGCAGTGAGCAATGTGTACCAGTTGCTTAAGCCTGGCGGCCTAGTCTGCTT
CCGTGACTATGGAAGAGGAGACTTGGCACAGGTCCGGTTTCGCAAGGGCCGGTATCTGCAAGAAAACTTTTATAT
TCGCGGTGACGGCACCCGCGTCTACTTTTTTGACAAGGATGAACTGGCTGATATATGGTCGGGGAAGAAATTTGA
GACTGAAATGGGAGTCGAGGCACCAAGGTTCGAGGTTGAGAACCTTGGTATTGACCGGCGACTGCTCATTAACCG
AGCACAAAAGATTAAAATGTATCGCTGTTGGATTCAGGGTCGCTTTAGAAAAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail