Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1836
Gene name
LocationContig_159:5321..5820
Strand-
Gene length (bp)499
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06093 Spt4 Spt4/RpoE2 zinc finger 2.0E-31 14 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S743|SPT4_NEUCR Transcription elongation factor spt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-2 PE=3 SV=1 1 121 1.0E-70
sp|Q4I5W5|SPT4_GIBZE Transcription elongation factor SPT4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT4 PE=3 SV=2 2 122 1.0E-69
sp|Q4WU00|SPT4_ASPFU Transcription elongation factor spt4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt4 PE=3 SV=1 2 112 8.0E-45
sp|Q9TVQ5|SPT4H_DROME Transcription elongation factor SPT4 OS=Drosophila melanogaster GN=spt4 PE=1 SV=1 8 104 5.0E-29
sp|P0CR68|SPT4_CRYNJ Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT4 PE=3 SV=1 14 117 8.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S743|SPT4_NEUCR Transcription elongation factor spt4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trf-2 PE=3 SV=1 1 121 1.0E-70
sp|Q4I5W5|SPT4_GIBZE Transcription elongation factor SPT4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT4 PE=3 SV=2 2 122 1.0E-69
sp|Q4WU00|SPT4_ASPFU Transcription elongation factor spt4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt4 PE=3 SV=1 2 112 8.0E-45
sp|Q9TVQ5|SPT4H_DROME Transcription elongation factor SPT4 OS=Drosophila melanogaster GN=spt4 PE=1 SV=1 8 104 5.0E-29
sp|P0CR68|SPT4_CRYNJ Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPT4 PE=3 SV=1 14 117 8.0E-29
sp|P0CR69|SPT4_CRYNB Transcription elongation factor SPT4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPT4 PE=3 SV=1 14 117 8.0E-29
sp|Q5AK73|SPT4_CANAL Transcription elongation factor SPT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT4 PE=3 SV=1 12 116 4.0E-27
sp|Q6DGQ0|SPT4H_DANRE Transcription elongation factor SPT4 OS=Danio rerio GN=supt4h1 PE=3 SV=1 8 114 1.0E-26
sp|Q6BHA5|SPT4_DEBHA Transcription elongation factor SPT4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPT4 PE=3 SV=2 12 116 1.0E-26
sp|Q5RFH5|SPT4H_PONAB Transcription elongation factor SPT4 OS=Pongo abelii GN=SUPT4H1 PE=3 SV=1 7 114 1.0E-26
sp|P63272|SPT4H_HUMAN Transcription elongation factor SPT4 OS=Homo sapiens GN=SUPT4H1 PE=1 SV=1 7 114 2.0E-26
sp|P63271|SPT4A_MOUSE Transcription elongation factor SPT4-A OS=Mus musculus GN=Supt4h1a PE=2 SV=1 7 114 2.0E-26
sp|Q3SYX6|SPT4H_BOVIN Transcription elongation factor SPT4 OS=Bos taurus GN=SUPT4H1 PE=3 SV=1 7 114 2.0E-26
sp|Q4R941|SPT4H_MACFA Transcription elongation factor SPT4 OS=Macaca fascicularis GN=SUPT4H1 PE=3 SV=1 7 114 2.0E-26
sp|Q9TZ93|SPT4H_CAEEL Transcription elongation factor SPT4 OS=Caenorhabditis elegans GN=spt-4 PE=3 SV=1 7 112 2.0E-26
sp|P32914|SPT4_YEAST Transcription elongation factor SPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT4 PE=1 SV=1 15 119 5.0E-26
sp|Q5HZ97|SPT4H_XENLA Transcription elongation factor SPT4 OS=Xenopus laevis GN=supt4h1 PE=3 SV=1 8 114 7.0E-26
sp|Q628A6|SPT4H_CAEBR Transcription elongation factor SPT4 OS=Caenorhabditis briggsae GN=spt-4 PE=3 SV=1 8 103 1.0E-25
sp|Q9Z199|SPT4B_MOUSE Transcription elongation factor SPT4-B OS=Mus musculus GN=Supt4h1b PE=2 SV=1 8 114 3.0E-25
sp|Q6FMX1|SPT4_CANGA Transcription elongation factor SPT4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPT4 PE=3 SV=1 15 119 6.0E-25
sp|P81205|SPT4_KLULA Transcription elongation factor SPT4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPT4 PE=3 SV=1 15 119 8.0E-25
sp|Q752J8|SPT4_ASHGO Transcription elongation factor SPT4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPT4 PE=3 SV=1 15 119 8.0E-25
sp|Q9P7K8|SPT4_SCHPO Transcription elongation factor spt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt4 PE=1 SV=1 15 116 5.0E-22
sp|Q94C60|SPT42_ARATH Transcription elongation factor SPT4 homolog 2 OS=Arabidopsis thaliana GN=At5g63670 PE=2 SV=1 14 111 1.0E-20
sp|Q8LCQ3|SPT41_ARATH Transcription elongation factor SPT4 homolog 1 OS=Arabidopsis thaliana GN=At5g08565 PE=2 SV=3 14 112 1.0E-20
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4777
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1836 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7379
Ophiocordyceps camponoti-floridani Ophcf2|04792
Ophiocordyceps camponoti-rufipedis Ophun1|50
Ophiocordyceps subramaniannii Hirsu2|10146

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1836
MASNFVTPGQQRYLRACMVCSVVMTYSRFRDEGCPNCEEFLHLAGSQDQIESCTSQVFEGLITLANPAKSWIAKW
QRLDGYVGGVYAIKVSGQLPDEVRSTLEDEYRVQYIPRDGTETEADA*
Coding >OphauG2|1836
ATGGCATCCAACTTTGTCACGCCAGGTCAGCAGCGCTATCTCCGCGCATGCATGGTGTGCTCCGTAGTCATGACA
TACAGCCGCTTCCGCGACGAGGGATGTCCCAACTGCGAAGAGTTTCTACACCTAGCCGGCTCACAAGACCAGATT
GAGAGCTGCACGTCGCAAGTCTTTGAAGGCCTCATCACCTTGGCCAACCCGGCAAAGTCGTGGATTGCAAAGTGG
CAGCGCCTCGATGGCTATGTCGGCGGGGTCTATGCTATCAAGGTTTCGGGACAGCTGCCGGATGAGGTGCGCTCG
ACTCTGGAGGATGAATATAGAGTGCAGTATATACCACGAGATGGCACAGAAACGGAGGCGGATGCTTAG
Transcript >OphauG2|1836
ATGGCATCCAACTTTGTCACGCCAGGTCAGCAGCGCTATCTCCGCGCATGCATGGTGTGCTCCGTAGTCATGACA
TACAGCCGCTTCCGCGACGAGGGATGTCCCAACTGCGAAGAGTTTCTACACCTAGCCGGCTCACAAGACCAGATT
GAGAGCTGCACGTCGCAAGTCTTTGAAGGCCTCATCACCTTGGCCAACCCGGCAAAGTCGTGGATTGCAAAGTGG
CAGCGCCTCGATGGCTATGTCGGCGGGGTCTATGCTATCAAGGTTTCGGGACAGCTGCCGGATGAGGTGCGCTCG
ACTCTGGAGGATGAATATAGAGTGCAGTATATACCACGAGATGGCACAGAAACGGAGGCGGATGCTTAG
Gene >OphauG2|1836
ATGGCATCCAACTTTGTCACGCCAGGTCAGCAGCGCTATCTCCGCGCATGCATGGTGTGCTCCGTAGTCATGACA
TACAGCGTAAAGCTCCTCTCTTTTCTTGGACCACCAAGTCTACGGCAGACTAACACGGTTGCAGCGCTTCCGCGA
CGAGGGATGTCCCAACTGCGAAGAGTTTCTACACCTAGCCGGCTCACAAGACCAGATTGAGAGCTGCACGTCGCA
AGTCTTTGAAGGCCTCATCACCTTGGCCAACCCGGCAAAGTCGTGGATTGCAAAGTGGCAGCGCCTCGATGGCTA
TGTCGGCGGGGTCTATGCTATCAAGGTTTCGGGACAGCTGCCGGATGAGGTGCGCTCGACTCTGGAGGATGAATA
TAGAGTGCAGTATATACCGTGAGTCTTTCTTTTTGTTTGAATCCTTTTGTTTTTTCCCCCTTGGAGTTTGGGAGC
TGACGGGGTTTGTAGACGAGATGGCACAGAAACGGAGGCGGATGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail