Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1824
Gene name
LocationContig_1581:1181..3016
Strand+
Gene length (bp)1835
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 1.5E-22 289 429
PF13649 Methyltransf_25 Methyltransferase domain 5.0E-12 308 396
PF08241 Methyltransf_11 Methyltransferase domain 2.2E-10 309 398
PF08242 Methyltransf_12 Methyltransferase domain 1.3E-07 309 398

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 306 460 5.0E-08
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 306 460 2.0E-07
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 306 411 3.0E-07
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 299 401 6.0E-06

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1824
MPVQESSSRQPAASRPSRLSFLDIVTNKDDEPVAPPSVRRPSTALEAPGVAWTPATGHQHKCPPPSDGACHGQRD
QSSYLPLQAPHDSHDSQRVPRPHAQMLPSLPQTFPEYASLASSHALGEPDLKAAGPSRRDDATLHNATSASWQPS
GSRLATSSQPGTGSQEQPLGSSTSQLDRAPMYYFGSHFNNVVDDDDYDDVAEEEALTQAEDSIVVDDAGQVAADA
YEDASDAGYGSEGFSSASTSAQSSIRDYLYENGRRYHRFREGAYNFPNDDLEQEREDLKHIMIKLLCGKKLHFAP
IGEHPQEILDIGTGTGIWAIEMGDEYPSANLLGIDLSPIQPDWLPPNVRFVVDDVESPWLYQLNHFDYIHSRHTV
MAIRDWTRLFRRAHEHLKPGGWIELQEIHHKPSSASLTGTMSAEHGVAQFWARVNEGLTTLGVDLDTAADGKLAD
MMRETGFVNIRQRVFHVPIGTWPKNKVLKKVGLYWRTILLDGLQAIALGPLTRGLRWNRDQIELFLMDVRRAYQD
NSALMFMPLYIIYAQKAHSAVA*
Coding >OphauG2|1824
ATGCCTGTCCAAGAGTCTTCCAGTCGTCAGCCCGCTGCCTCTCGGCCAAGCCGCTTATCCTTTCTCGACATTGTC
ACCAACAAAGACGACGAACCTGTTGCTCCGCCGTCGGTTCGCCGCCCCAGCACAGCGTTGGAGGCCCCCGGAGTG
GCCTGGACACCAGCTACTGGCCACCAACATAAATGTCCGCCACCAAGTGATGGTGCTTGCCATGGGCAGCGCGAC
CAAAGCTCGTATCTGCCACTGCAAGCCCCTCACGACAGCCATGATAGCCAGAGAGTCCCTCGGCCACACGCACAG
ATGCTTCCGTCCCTGCCACAGACATTTCCAGAGTATGCATCTTTGGCCTCGAGCCATGCATTGGGGGAGCCAGAC
TTGAAGGCTGCAGGCCCCTCGAGACGGGACGACGCCACCCTTCACAACGCCACATCCGCATCGTGGCAGCCAAGC
GGCAGCAGACTGGCCACATCGTCACAGCCAGGCACTGGGTCACAGGAGCAGCCGCTTGGCTCGTCGACGTCGCAG
CTTGACCGAGCGCCCATGTACTATTTCGGGTCACATTTCAATAACGTTGTTGATGACGATGATTACGACGACGTT
GCCGAGGAGGAGGCCCTGACGCAGGCCGAGGACTCTATCGTGGTGGACGACGCAGGCCAAGTCGCTGCTGATGCA
TATGAAGACGCGTCAGACGCGGGTTACGGGAGTGAAGGTTTCAGCTCAGCCAGCACTTCGGCGCAATCCTCAATA
CGTGATTATCTCTATGAAAATGGGAGAAGATATCACCGATTTCGCGAGGGAGCGTACAACTTCCCCAACGACGAT
TTGGAGCAAGAGCGAGAGGACCTCAAGCACATAATGATCAAGCTATTGTGCGGCAAGAAGCTACACTTTGCTCCG
ATAGGCGAACACCCTCAAGAAATTCTCGACATTGGAACGGGCACAGGCATTTGGGCCATTGAAATGGGTGATGAG
TACCCGAGCGCCAATTTGCTGGGCATCGATCTGTCGCCAATCCAGCCCGACTGGTTGCCACCCAATGTGCGTTTC
GTAGTCGACGATGTCGAGTCTCCCTGGCTCTACCAGCTCAATCACTTTGACTATATACACTCGAGGCATACCGTC
ATGGCCATTCGAGACTGGACGCGACTGTTTCGAAGGGCACACGAACATTTAAAGCCAGGGGGCTGGATTGAGCTG
CAGGAAATCCACCACAAGCCTAGTAGTGCGTCGTTGACGGGCACAATGTCCGCGGAACACGGAGTGGCACAGTTT
TGGGCCCGCGTCAATGAAGGCCTGACGACTCTGGGCGTGGATCTCGACACAGCGGCAGATGGAAAGTTGGCCGAC
ATGATGCGCGAGACGGGCTTCGTCAACATCAGGCAGCGTGTCTTTCACGTGCCCATTGGCACGTGGCCCAAGAAC
AAGGTGCTTAAGAAGGTGGGCTTGTATTGGCGCACCATTCTGCTTGACGGGCTGCAGGCCATTGCGCTGGGGCCC
CTGACGCGCGGATTGCGCTGGAACCGAGACCAGATTGAGCTTTTTCTCATGGACGTGCGGCGGGCTTACCAGGAC
AACTCGGCGCTCATGTTCATGCCGCTGTATATTATATACGCGCAAAAGGCGCATAGTGCGGTGGCATGA
Transcript >OphauG2|1824
ATGCCTGTCCAAGAGTCTTCCAGTCGTCAGCCCGCTGCCTCTCGGCCAAGCCGCTTATCCTTTCTCGACATTGTC
ACCAACAAAGACGACGAACCTGTTGCTCCGCCGTCGGTTCGCCGCCCCAGCACAGCGTTGGAGGCCCCCGGAGTG
GCCTGGACACCAGCTACTGGCCACCAACATAAATGTCCGCCACCAAGTGATGGTGCTTGCCATGGGCAGCGCGAC
CAAAGCTCGTATCTGCCACTGCAAGCCCCTCACGACAGCCATGATAGCCAGAGAGTCCCTCGGCCACACGCACAG
ATGCTTCCGTCCCTGCCACAGACATTTCCAGAGTATGCATCTTTGGCCTCGAGCCATGCATTGGGGGAGCCAGAC
TTGAAGGCTGCAGGCCCCTCGAGACGGGACGACGCCACCCTTCACAACGCCACATCCGCATCGTGGCAGCCAAGC
GGCAGCAGACTGGCCACATCGTCACAGCCAGGCACTGGGTCACAGGAGCAGCCGCTTGGCTCGTCGACGTCGCAG
CTTGACCGAGCGCCCATGTACTATTTCGGGTCACATTTCAATAACGTTGTTGATGACGATGATTACGACGACGTT
GCCGAGGAGGAGGCCCTGACGCAGGCCGAGGACTCTATCGTGGTGGACGACGCAGGCCAAGTCGCTGCTGATGCA
TATGAAGACGCGTCAGACGCGGGTTACGGGAGTGAAGGTTTCAGCTCAGCCAGCACTTCGGCGCAATCCTCAATA
CGTGATTATCTCTATGAAAATGGGAGAAGATATCACCGATTTCGCGAGGGAGCGTACAACTTCCCCAACGACGAT
TTGGAGCAAGAGCGAGAGGACCTCAAGCACATAATGATCAAGCTATTGTGCGGCAAGAAGCTACACTTTGCTCCG
ATAGGCGAACACCCTCAAGAAATTCTCGACATTGGAACGGGCACAGGCATTTGGGCCATTGAAATGGGTGATGAG
TACCCGAGCGCCAATTTGCTGGGCATCGATCTGTCGCCAATCCAGCCCGACTGGTTGCCACCCAATGTGCGTTTC
GTAGTCGACGATGTCGAGTCTCCCTGGCTCTACCAGCTCAATCACTTTGACTATATACACTCGAGGCATACCGTC
ATGGCCATTCGAGACTGGACGCGACTGTTTCGAAGGGCACACGAACATTTAAAGCCAGGGGGCTGGATTGAGCTG
CAGGAAATCCACCACAAGCCTAGTAGTGCGTCGTTGACGGGCACAATGTCCGCGGAACACGGAGTGGCACAGTTT
TGGGCCCGCGTCAATGAAGGCCTGACGACTCTGGGCGTGGATCTCGACACAGCGGCAGATGGAAAGTTGGCCGAC
ATGATGCGCGAGACGGGCTTCGTCAACATCAGGCAGCGTGTCTTTCACGTGCCCATTGGCACGTGGCCCAAGAAC
AAGGTGCTTAAGAAGGTGGGCTTGTATTGGCGCACCATTCTGCTTGACGGGCTGCAGGCCATTGCGCTGGGGCCC
CTGACGCGCGGATTGCGCTGGAACCGAGACCAGATTGAGCTTTTTCTCATGGACGTGCGGCGGGCTTACCAGGAC
AACTCGGCGCTCATGTTCATGCCGCTGTATATTATATACGCGCAAAAGGCGCATAGTGCGGTGGCATGA
Gene >OphauG2|1824
ATGCCTGTCCAAGAGTCTTCCAGTCGTCAGCCCGCTGCCTCTCGGCCAAGCCGCTTATCCTTTCTCGACATTGTC
ACCAACAAAGACGACGAACCTGTTGCTCCGCCGTCGGTTCGCCGCCCCAGCACAGCGTTGGAGGCCCCCGGAGTG
GCCTGGACACCAGCTACTGGCCACCAACATAAATGTCCGCCACCAAGTGATGGTGCTTGCCATGGGCAGCGCGAC
CAAAGCTCGTATCTGCCACTGCAAGCCCCTCACGACAGCCATGATAGCCAGAGAGTCCCTCGGCCACACGCACAG
ATGCTTCCGTCCCTGCCACAGACATTTCCAGAGTATGCATCTTTGGCCTCGAGCCATGCATTGGGGGAGCCAGAC
TTGAAGGCTGCAGGCCCCTCGAGACGGGACGACGCCACCCTTCACAACGCCACATCCGCATCGTGGCAGCCAAGC
GGCAGCAGACTGGCCACATCGTCACAGCCAGGCACTGGGTCACAGGAGCAGCCGCTTGGCTCGTCGACGTCGCAG
CTTGACCGAGCGCCCATGTACTATTTCGGGTCACATTTCAATAACGTTGTTGATGACGATGATTACGACGACGTT
GCCGAGGAGGAGGCCCTGACGCAGGCCGAGGACTCTATCGTGGTGGACGACGCAGGCCAAGTCGCTGCTGATGCA
TATGAAGACGCGTCAGACGCGGGTTACGGGAGTGAAGGTTTCAGCTCAGCCAGCACTTCGGCGCAATCCTCAATA
CGTGATTATCTCTATGAAAATGGGAGAAGATATCACCGATTTCGCGAGGGAGCGTACAACTTCCCCAACGACGAT
TTGGAGCAAGAGGTAGGCGCATACAAGGCTCCTACCAGACACTATGCCTCGCCGAGGAGAAGCTGATTGTCGAGA
TAGCGAGAGGACCTCAAGCACATAATGATCAAGCTATTGTGCGGCAAGAAGCTACACTTTGCTCCGATAGGCGAA
CACCCTCAAGAAATTCTCGACATTGGAACGGGCACAGGCATTTGGGCCATTGAAAGTCAGTCTTTTCGTTTTGTA
CTCGACGTAGCTGGCTGACACCAAGACGAAACAGTGGGTGATGAGTACCCGAGCGCCAATTTGCTGGGCATCGAT
CTGTCGCCAATCCAGCCCGACTGGTTGCCACCCAATGTGCGTTTCGTAGTCGACGATGTCGAGTCTCCCTGGCTC
TACCAGCTCAATCACTTTGACTATATACACTCGAGGCATACCGTCATGGCCATTCGAGACTGGACGCGACTGTTT
CGAAGGGCACACGAGTAAGTGGTTTGAGCAGCTGAGGCTGAGTGACGGGCTGTGCTGACAAGAGAACCAAAAAAA
AAAATGATAGACATTTAAAGCCAGGGGGCTGGATTGAGCTGCAGGAAATCCACCACAAGCCTAGTAGTGCGTCGT
TGACGGGCACAATGTCCGCGGAACACGGAGTGGCACAGTTTTGGGCCCGCGTCAATGAAGGCCTGACGACTCTGG
GCGTGGATCTCGACACAGCGGCAGATGGAAAGTTGGCCGACATGATGCGCGAGACGGGCTTCGTCAACATCAGGC
AGCGTGTCTTTCACGTGCCCATTGGCACGTGGCCCAAGAACAAGGTGCTTAAGAAGGTGGGCTTGTATTGGCGCA
CCATTCTGCTTGACGGGCTGCAGGCCATTGCGCTGGGGCCCCTGACGCGCGGATTGCGCTGGAACCGAGACCAGA
TTGAGCTTTTTCTCATGGACGTGCGGCGGGCTTACCAGGACAACTCGGCGCTCATGTTCATGCCGCTGTATATTA
TATACGCGCAAAAGGCGCATAGTGCGGTGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail