© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|1813 |
| Gene name | |
| Location | Contig_1579:1660..2552 |
| Strand | - |
| Gene length (bp) | 892 |
| Transcript length (bp) | 744 |
| Coding sequence length (bp) | 744 |
| Protein length (aa) | 248 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00501 | AMP-binding | AMP-binding enzyme | 1.5E-42 | 23 | 244 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 27 | 244 | 2.0E-48 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 28 | 244 | 4.0E-47 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 28 | 244 | 4.0E-47 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 26 | 244 | 1.0E-46 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 28 | 244 | 2.0E-46 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 27 | 244 | 2.0E-48 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 28 | 244 | 4.0E-47 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 28 | 244 | 4.0E-47 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 26 | 244 | 1.0E-46 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 28 | 244 | 2.0E-46 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 21 | 244 | 1.0E-44 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 23 | 244 | 1.0E-43 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 18 | 241 | 7.0E-43 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 28 | 244 | 8.0E-43 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 22 | 247 | 1.0E-41 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 21 | 235 | 1.0E-41 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 27 | 246 | 2.0E-40 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 26 | 246 | 2.0E-40 |
| sp|Q4WYP0|NRPS6_ASPFU | Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 | 1 | 244 | 2.0E-40 |
| sp|Q4WLW8|NRP11_ASPFU | Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 | 15 | 244 | 2.0E-39 |
| sp|Q4WMK2|NRPS9_ASPFU | Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 | 7 | 229 | 2.0E-38 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 29 | 244 | 1.0E-37 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 18 | 244 | 2.0E-37 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 20 | 241 | 3.0E-35 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 27 | 241 | 2.0E-34 |
| sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 20 | 244 | 2.0E-34 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 18 | 235 | 2.0E-34 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 16 | 244 | 4.0E-33 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 16 | 244 | 5.0E-33 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 33 | 246 | 6.0E-33 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 24 | 244 | 2.0E-31 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 29 | 242 | 8.0E-29 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 27 | 244 | 3.0E-28 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 18 | 244 | 3.0E-27 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 21 | 234 | 4.0E-27 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 15 | 235 | 2.0E-26 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 25 | 234 | 8.0E-26 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 24 | 234 | 1.0E-25 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 27 | 236 | 2.0E-24 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 18 | 235 | 3.0E-24 |
| sp|P35854|DLTA_LACRH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 | 5 | 244 | 8.0E-24 |
| sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 19 | 234 | 1.0E-23 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 26 | 234 | 1.0E-23 |
| sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 19 | 234 | 2.0E-23 |
| sp|Q88VM6|DLTA_LACPL | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 | 15 | 244 | 4.0E-23 |
| sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 30 | 243 | 2.0E-22 |
| sp|B3WC77|DLTA_LACCB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 | 17 | 244 | 3.0E-22 |
| sp|Q03AZ2|DLTA_LACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 | 17 | 244 | 3.0E-22 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 33 | 235 | 4.0E-22 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 20 | 241 | 1.0E-21 |
| sp|A7GMR0|DLTA_BACCN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 | 22 | 236 | 1.0E-21 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 22 | 243 | 1.0E-21 |
| sp|A0AH92|DLTA_LISW6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 | 22 | 241 | 2.0E-21 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 21 | 234 | 7.0E-21 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 21 | 236 | 9.0E-21 |
| sp|Q92D47|DLTA_LISIN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 | 22 | 241 | 1.0E-20 |
| sp|Q9CG49|DLTA_LACLA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 | 16 | 244 | 2.0E-20 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 22 | 241 | 6.0E-20 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 22 | 241 | 7.0E-20 |
| sp|B8DEG2|DLTA_LISMH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 | 27 | 241 | 7.0E-20 |
| sp|Q81G39|DLTA_BACCR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 | 22 | 244 | 1.0E-19 |
| sp|B7HHC6|DLTA_BACC4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|B9IUW2|DLTA_BACCQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|Q73BD2|DLTA_BACC1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|Q63E02|DLTA_BACCZ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|Q81T97|DLTA_BACAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|C3LAH8|DLTA_BACAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|C3P4I7|DLTA_BACAA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|Q6HLH7|DLTA_BACHK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|C1EM80|DLTA_BACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|B7JFV5|DLTA_BACC0 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|A0RBJ0|DLTA_BACAH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 | 22 | 244 | 1.0E-19 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 34 | 247 | 2.0E-19 |
| sp|Q8Y8D4|DLTA_LISMO | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 | 27 | 241 | 2.0E-19 |
| sp|A9VKV6|DLTA_BACWK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 | 22 | 236 | 2.0E-19 |
| sp|Q721J2|DLTA_LISMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 | 27 | 241 | 3.0E-19 |
| sp|B7IN64|DLTA_BACC2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 | 22 | 244 | 3.0E-19 |
| sp|C1L1P5|DLTA_LISMC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 | 27 | 241 | 4.0E-19 |
| sp|Q1J667|DLTA_STRPF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 | 26 | 244 | 4.0E-19 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 27 | 241 | 5.0E-19 |
| sp|B7HK95|DLTA_BACC7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 | 22 | 244 | 6.0E-19 |
| sp|A7ZA74|DLTA_BACMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 | 22 | 236 | 9.0E-19 |
| sp|Q48SZ3|DLTA_STRPM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 | 26 | 244 | 1.0E-18 |
| sp|B5XLX5|DLTA_STRPZ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 | 26 | 244 | 1.0E-18 |
| sp|A2RE45|DLTA_STRPG | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 | 26 | 244 | 1.0E-18 |
| sp|Q1JGF0|DLTA_STRPD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 | 26 | 244 | 1.0E-18 |
| sp|Q8P0J9|DLTA_STRP8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 | 26 | 244 | 1.0E-18 |
| sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 19 | 241 | 2.0E-18 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 29 | 242 | 2.0E-18 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 21 | 244 | 3.0E-18 |
| sp|P0DA65|DLTA_STRPQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 | 26 | 244 | 3.0E-18 |
| sp|P0DA64|DLTA_STRP3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 | 26 | 244 | 3.0E-18 |
| sp|Q1JLB7|DLTA_STRPC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 | 26 | 244 | 3.0E-18 |
| sp|Q5XBN5|DLTA_STRP6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 | 26 | 244 | 3.0E-18 |
| sp|Q99ZA6|DLTA_STRP1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 | 26 | 244 | 3.0E-18 |
| sp|C0MBD6|DLTA_STRE4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 | 27 | 244 | 4.0E-18 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 23 | 235 | 8.0E-18 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 28 | 246 | 1.0E-17 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 33 | 244 | 1.0E-17 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 21 | 235 | 1.0E-17 |
| sp|Q53526|DLTA_STRMU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 | 26 | 244 | 1.0E-17 |
| sp|Q9L9G0|NOVH_STRNV | Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 | 30 | 241 | 1.0E-17 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 23 | 241 | 1.0E-17 |
| sp|Q65DH1|DLTA_BACLD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 | 20 | 244 | 2.0E-17 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 24 | 242 | 3.0E-17 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 27 | 246 | 4.0E-17 |
| sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 21 | 242 | 6.0E-17 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 21 | 235 | 7.0E-17 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 21 | 242 | 2.0E-16 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 22 | 235 | 3.0E-16 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 30 | 244 | 3.0E-16 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 30 | 241 | 4.0E-16 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 29 | 241 | 4.0E-16 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 26 | 235 | 5.0E-16 |
| sp|C1CNE9|DLTA_STRZP | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 | 27 | 244 | 5.0E-16 |
| sp|P0A399|DLTA_STRR6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 | 27 | 244 | 5.0E-16 |
| sp|P0A398|DLTA_STRPN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 | 27 | 244 | 5.0E-16 |
| sp|Q04HZ7|DLTA_STRP2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 | 27 | 244 | 5.0E-16 |
| sp|C1CB20|DLTA_STRP7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 | 27 | 244 | 5.0E-16 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 24 | 235 | 6.0E-16 |
| sp|C1CU95|DLTA_STRZT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 | 27 | 244 | 6.0E-16 |
| sp|B8ZQ14|DLTA_STRPJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 | 27 | 244 | 6.0E-16 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 18 | 236 | 6.0E-16 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 31 | 241 | 7.0E-16 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 28 | 242 | 8.0E-16 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 22 | 246 | 8.0E-16 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 30 | 242 | 9.0E-16 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 19 | 235 | 1.0E-15 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 19 | 235 | 1.0E-15 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 30 | 242 | 1.0E-15 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 30 | 241 | 2.0E-15 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 26 | 241 | 2.0E-15 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 21 | 235 | 2.0E-15 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 33 | 235 | 2.0E-15 |
| sp|P59591|DLTA_STRA5 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 | 26 | 244 | 3.0E-15 |
| sp|Q3JZ94|DLTA_STRA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 | 26 | 244 | 3.0E-15 |
| sp|P39581|DLTA_BACSU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 | 22 | 244 | 3.0E-15 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 22 | 242 | 4.0E-15 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 11 | 234 | 4.0E-15 |
| sp|Q8VM67|DLTA_STRA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 | 26 | 244 | 4.0E-15 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 28 | 241 | 5.0E-15 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 29 | 235 | 6.0E-15 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 21 | 236 | 6.0E-15 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 26 | 244 | 7.0E-15 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 28 | 242 | 1.0E-14 |
| sp|Q01757|ACVS_STRCL | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 | 19 | 241 | 1.0E-14 |
| sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 28 | 235 | 2.0E-14 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 29 | 241 | 2.0E-14 |
| sp|P0DJH0|ANGR_VIBAN | Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 | 22 | 246 | 2.0E-14 |
| sp|Q6W4T3|ANGR_VIBA7 | Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 | 22 | 246 | 2.0E-14 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 31 | 241 | 3.0E-14 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 27 | 246 | 4.0E-14 |
| sp|Q1B6A7|MBTB_MYCSS | Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 | 19 | 241 | 6.0E-14 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 29 | 235 | 7.0E-14 |
| sp|P68878|DLTA_STAAW | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|A8Z1J1|DLTA_STAAT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|Q6GAZ4|DLTA_STAAS | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|A6QFE3|DLTA_STAAE | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|Q5HHF2|DLTA_STAAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|Q2FZW6|DLTA_STAA8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|Q2FIE3|DLTA_STAA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 | 25 | 241 | 7.0E-14 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 28 | 244 | 8.0E-14 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 28 | 242 | 8.0E-14 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 236 | 8.0E-14 |
| sp|Q6GIF6|DLTA_STAAR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 | 25 | 241 | 8.0E-14 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 236 | 9.0E-14 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 33 | 234 | 1.0E-13 |
| sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 21 | 235 | 1.0E-13 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 14 | 241 | 1.0E-13 |
| sp|A1CLY8|CCSA_ASPCL | Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 | 23 | 238 | 1.0E-13 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 33 | 241 | 2.0E-13 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 29 | 244 | 2.0E-13 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 26 | 241 | 3.0E-13 |
| sp|Q5HQN0|DLTA_STAEQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 | 25 | 244 | 3.0E-13 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 28 | 234 | 4.0E-13 |
| sp|Q8CT93|DLTA_STAES | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 | 25 | 244 | 6.0E-13 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 21 | 241 | 6.0E-13 |
| sp|P9WQ63|MBTB_MYCTU | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 | 28 | 236 | 7.0E-13 |
| sp|Q7TYQ4|MBTB_MYCBO | Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 | 28 | 236 | 7.0E-13 |
| sp|P9WQ62|MBTB_MYCTO | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 | 28 | 236 | 7.0E-13 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 33 | 241 | 9.0E-13 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 21 | 235 | 1.0E-12 |
| sp|Q4L4U5|DLTA_STAHJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 | 30 | 244 | 1.0E-12 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 22 | 236 | 2.0E-12 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 34 | 241 | 2.0E-12 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 34 | 241 | 2.0E-12 |
| sp|P0C397|DLTA_STAAU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 | 25 | 241 | 2.0E-12 |
| sp|P99107|DLTA_STAAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 | 25 | 241 | 2.0E-12 |
| sp|P68876|DLTA_STAAM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 | 25 | 241 | 2.0E-12 |
| sp|A5IRB0|DLTA_STAA9 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 | 25 | 241 | 2.0E-12 |
| sp|A6U039|DLTA_STAA2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 | 25 | 241 | 2.0E-12 |
| sp|A7X0D6|DLTA_STAA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 | 25 | 241 | 2.0E-12 |
| sp|E2JA29|DDAD_ENTAG | Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 | 33 | 241 | 3.0E-12 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 22 | 236 | 5.0E-12 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 33 | 242 | 5.0E-12 |
| sp|Q84P23|4CLL9_ARATH | 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 | 12 | 238 | 6.0E-12 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 30 | 235 | 7.0E-12 |
| sp|O74298|LYS2_PENCH | L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 | 19 | 236 | 8.0E-12 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 30 | 235 | 9.0E-12 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 22 | 241 | 9.0E-12 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 34 | 241 | 1.0E-11 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 7 | 235 | 1.0E-11 |
| sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 27 | 243 | 1.0E-11 |
| sp|P48633|HMWP2_YERE8 | High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 | 28 | 236 | 1.0E-11 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 22 | 241 | 2.0E-11 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 21 | 235 | 2.0E-11 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 25 | 236 | 2.0E-11 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 25 | 236 | 2.0E-11 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 30 | 235 | 3.0E-11 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 27 | 242 | 3.0E-11 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 30 | 235 | 3.0E-11 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 28 | 246 | 3.0E-11 |
| sp|Q10S72|4CLL4_ORYSJ | 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 | 24 | 243 | 3.0E-11 |
| sp|Q9X2N4|DLTA_STAXY | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 | 24 | 241 | 3.0E-11 |
| sp|Q3E6Y4|4CLL3_ARATH | 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 | 27 | 241 | 4.0E-11 |
| sp|O31827|PPSE_BACSU | Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 | 28 | 243 | 5.0E-11 |
| sp|Q00868|ESYN_GIBPU | Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 | 28 | 234 | 6.0E-11 |
| sp|P0C5B6|4CLL4_ARATH | 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 | 27 | 241 | 8.0E-11 |
| sp|Q84P25|4CLL2_ARATH | 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 | 18 | 241 | 1.0E-10 |
| sp|Q73XY1|MBTB_MYCPA | Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 | 27 | 241 | 1.0E-10 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 33 | 241 | 2.0E-10 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 28 | 234 | 3.0E-10 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 29 | 235 | 3.0E-10 |
| sp|Q4WAZ9|NRP14_ASPFU | Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 | 29 | 243 | 3.0E-10 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 21 | 235 | 4.0E-10 |
| sp|Q9R9J1|MYCA_BACIU | Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 | 30 | 241 | 7.0E-10 |
| sp|P40976|LYS2_SCHPO | L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 | 27 | 241 | 9.0E-10 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 16 | 241 | 1.0E-09 |
| sp|Q69RG7|4CLL7_ORYSJ | 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 | 23 | 236 | 1.0E-09 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 20 | 234 | 2.0E-09 |
| sp|Q6FMI5|LYS2_CANGA | L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 | 27 | 242 | 3.0E-09 |
| sp|Q84P21|4CLL5_ARATH | 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 | 24 | 243 | 3.0E-09 |
| sp|Q84P26|4CLL8_ARATH | 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 | 24 | 240 | 3.0E-09 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 29 | 242 | 4.0E-09 |
| sp|P08659|LUCI_PHOPY | Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 | 12 | 243 | 4.0E-09 |
| sp|Q75BB3|LYS2_ASHGO | L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 | 27 | 242 | 6.0E-09 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 21 | 241 | 7.0E-09 |
| sp|P07702|LYS2_YEAST | L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 | 27 | 242 | 7.0E-09 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 21 | 234 | 1.0E-08 |
| sp|Q42982|4CL2_ORYSJ | Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 | 21 | 243 | 1.0E-08 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 21 | 241 | 2.0E-08 |
| sp|Q7WSH3|FADD3_COMTE | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 | 27 | 242 | 2.0E-08 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 27 | 206 | 3.0E-08 |
| sp|O24146|4CL2_TOBAC | 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 | 20 | 236 | 5.0E-08 |
| sp|B2VFS7|AAS_ERWT9 | Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 | 14 | 238 | 5.0E-08 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 30 | 244 | 8.0E-08 |
| sp|Q84P24|4CLL6_ARATH | 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 | 23 | 236 | 5.0E-07 |
| sp|P31687|4CL2_SOYBN | 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 | 23 | 241 | 6.0E-07 |
| sp|A6TDH2|AAS_KLEP7 | Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 | 13 | 239 | 7.0E-07 |
| sp|Q01158|LUCI_LUCLA | Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 | 30 | 235 | 8.0E-07 |
| sp|P11454|ENTF_ECOLI | Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 | 4 | 241 | 1.0E-06 |
| sp|P13129|LUCI_LUCCR | Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 | 30 | 242 | 1.0E-06 |
| sp|Q8XBV9|ENTF_ECO57 | Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 | 16 | 241 | 1.0E-06 |
| sp|P29698|ENTF_SHIFL | Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 | 16 | 241 | 1.0E-06 |
| sp|O24540|4CL_VANPL | 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 | 20 | 236 | 1.0E-06 |
| sp|B5XUP2|AAS_KLEP3 | Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 | 14 | 239 | 2.0E-06 |
| sp|Q8ZMA4|AAS_SALTY | Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B5F4V4|AAS_SALA4 | Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|A9N3H8|AAS_SALPB | Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B4TGR5|AAS_SALHS | Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B5QWU2|AAS_SALEP | Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|Q8Z406|AAS_SALTI | Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B4TUM9|AAS_SALSV | Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B5BFH6|AAS_SALPK | Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|Q5PEN7|AAS_SALPA | Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B5RDY6|AAS_SALG2 | Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B4T503|AAS_SALNS | Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 | 13 | 239 | 2.0E-06 |
| sp|B5FUB9|AAS_SALDC | Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 | 13 | 239 | 4.0E-06 |
| sp|C0PXJ8|AAS_SALPC | Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 | 13 | 239 | 7.0E-06 |
| sp|Q57KA7|AAS_SALCH | Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 | 13 | 239 | 7.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|1813 MPLIPRIASPPSSHFLPPLHSSPKTAVSPSNAAFVLFTSGSTGTPKGLVQQHSSVCSVNAAYHDSLFLNHSSRVL NFAAYTFDVSTVDVFATLSLGGCVCIPSEAERLNDLEGAIQRFNVTWIDLTPSFAVASIPDPRRVPSLQTLVLAG EPLQPHHAAHFVGRVPRVINCYGPAEAGGCLAQICEAGDAAPAVGRAMPSARCWVVDVRDARRLASVGAVGELVV EGPTLARGYLGLEDKTKAAALL* |
| Coding | >OphauG2|1813 ATGCCTCTCATCCCACGCATCGCCTCGCCTCCATCCTCACACTTTCTCCCGCCGCTGCACTCCTCCCCCAAAACC GCCGTCTCTCCCTCCAACGCCGCCTTTGTCCTCTTCACCTCGGGCAGCACCGGCACCCCCAAGGGCCTTGTCCAG CAACACAGCTCCGTCTGCAGCGTCAACGCCGCCTACCACGATTCTCTCTTCCTCAACCACTCGTCGCGCGTGCTC AACTTTGCCGCGTACACGTTTGACGTGAGCACCGTGGACGTGTTTGCCACGCTCTCGCTCGGCGGCTGCGTGTGC ATCCCGTCAGAGGCCGAGCGCCTCAACGACCTTGAAGGCGCCATCCAGCGCTTCAACGTGACCTGGATCGACCTG ACCCCGTCGTTTGCCGTTGCCAGCATCCCGGACCCGCGCCGCGTGCCGTCGCTGCAGACGCTCGTTTTGGCTGGC GAGCCGCTGCAGCCACACCACGCCGCGCACTTTGTCGGGCGGGTGCCGCGCGTCATCAACTGCTACGGCCCGGCA GAGGCGGGCGGCTGCTTGGCCCAGATATGTGAGGCGGGCGATGCGGCGCCGGCGGTGGGCCGAGCGATGCCCAGC GCGCGCTGCTGGGTGGTGGATGTGAGAGACGCGCGCCGGCTGGCCAGTGTGGGCGCCGTGGGCGAGCTGGTGGTG GAAGGGCCGACGCTGGCGCGCGGGTATCTCGGGCTCGAGGACAAGACCAAGGCGGCGGCGCTTCTATAA |
| Transcript | >OphauG2|1813 ATGCCTCTCATCCCACGCATCGCCTCGCCTCCATCCTCACACTTTCTCCCGCCGCTGCACTCCTCCCCCAAAACC GCCGTCTCTCCCTCCAACGCCGCCTTTGTCCTCTTCACCTCGGGCAGCACCGGCACCCCCAAGGGCCTTGTCCAG CAACACAGCTCCGTCTGCAGCGTCAACGCCGCCTACCACGATTCTCTCTTCCTCAACCACTCGTCGCGCGTGCTC AACTTTGCCGCGTACACGTTTGACGTGAGCACCGTGGACGTGTTTGCCACGCTCTCGCTCGGCGGCTGCGTGTGC ATCCCGTCAGAGGCCGAGCGCCTCAACGACCTTGAAGGCGCCATCCAGCGCTTCAACGTGACCTGGATCGACCTG ACCCCGTCGTTTGCCGTTGCCAGCATCCCGGACCCGCGCCGCGTGCCGTCGCTGCAGACGCTCGTTTTGGCTGGC GAGCCGCTGCAGCCACACCACGCCGCGCACTTTGTCGGGCGGGTGCCGCGCGTCATCAACTGCTACGGCCCGGCA GAGGCGGGCGGCTGCTTGGCCCAGATATGTGAGGCGGGCGATGCGGCGCCGGCGGTGGGCCGAGCGATGCCCAGC GCGCGCTGCTGGGTGGTGGATGTGAGAGACGCGCGCCGGCTGGCCAGTGTGGGCGCCGTGGGCGAGCTGGTGGTG GAAGGGCCGACGCTGGCGCGCGGGTATCTCGGGCTCGAGGACAAGACCAAGGCGGCGGCGCTTCTATAA |
| Gene | >OphauG2|1813 ATGCCTCTCATCCCACGCATCGCCTCGCCTCCATCCTCACACTTGTCCAGCCCAAGCTGGTGCTCGCGTCGGAAC ACACCGCCCCTGTTTTTGCCTCGTTTTCTCTCCCCGTCATCGTCGTCAACGACGCTCTACTAACTAGTCTCCCGC CGCTGCACTCCTCCCCCAAAACCGCCGTCTCTCCCTCCAACGCCGCCTTTGTCCTCTTCACCTCGGGCAGCACCG GCACCCCCAAGGGCCTTGTCCAGCAACACAGCTCCGTCTGCAGCGTCAACGCCGCCTACCACGATTCTCTCTTCC TCAACCACTCGTCGCGCGTGCTCAACTTTGCCGCGTACACGTTTGACGTGAGCACCGTGGACGTGTTTGCCACGC TCTCGCTCGGCGGCTGCGTGTGCATCCCGTCAGAGGCCGAGCGCCTCAACGACCTTGAAGGCGCCATCCAGCGCT TCAACGTGACCTGGATCGACCTGACCCCGTCGTTTGCCGTTGCCAGCATCCCGGACCCGCGCCGCGTGCCGTCGC TGCAGACGCTCGTTTTGGCTGGCGAGCCGCTGCAGCCACACCACGCCGCGCACTTTGTCGGGCGGGTGCCGCGCG TCATCAACTGCTACGGCCCGGCAGAGGCGGGCGGCTGCTTGGCCCAGATATGTGAGGCGGGCGATGCGGCGCCGG CGGTGGGCCGAGCGATGCCCAGCGCGCGCTGCTGGGTGGTGGATGTGAGAGACGCGCGCCGGCTGGCCAGTGTGG GCGCCGTGGGCGAGCTGGTGGTGGAAGGGCCGACGCTGGCGCGCGGGTATCTCGGGCTCGAGGACAAGACCAAGG CGGTGTTTGTGCGGCATGGCGGGTGGCGGTGCGTGGACCGGCTGAGGCCAAGGCGGCGCTTCTATAA |