Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1809
Gene name
LocationContig_1576:779..2843
Strand-
Gene length (bp)2064
Transcript length (bp)2064
Coding sequence length (bp)2064
Protein length (aa) 688

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04727 ELMO_CED12 ELMO/CED-12 family 6.5E-42 242 430
PF16457 PH_12 Pleckstrin homology domain 3.4E-36 501 630
PF11841 ELMO_ARM ELMO, armadillo-like helical domain 1.9E-13 37 177

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 9 668 2.0E-26
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 9 668 6.0E-26
sp|Q96BJ8|ELMO3_HUMAN Engulfment and cell motility protein 3 OS=Homo sapiens GN=ELMO3 PE=1 SV=3 9 657 1.0E-25
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 9 668 3.0E-25
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 9 687 5.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 9 668 2.0E-26
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 9 668 6.0E-26
sp|Q96BJ8|ELMO3_HUMAN Engulfment and cell motility protein 3 OS=Homo sapiens GN=ELMO3 PE=1 SV=3 9 657 1.0E-25
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 9 668 3.0E-25
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 9 687 5.0E-25
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 9 687 1.0E-24
sp|Q8BHL5|ELMO2_MOUSE Engulfment and cell motility protein 2 OS=Mus musculus GN=Elmo2 PE=1 SV=1 9 668 5.0E-24
sp|Q499U2|ELMO3_RAT Engulfment and cell motility protein 3 OS=Rattus norvegicus GN=Elmo3 PE=2 SV=1 301 657 4.0E-23
sp|Q8BYZ7|ELMO3_MOUSE Engulfment and cell motility protein 3 OS=Mus musculus GN=Elmo3 PE=1 SV=2 301 657 1.0E-22
sp|A6QR40|ELMO3_BOVIN Engulfment and cell motility protein 3 OS=Bos taurus GN=ELMO3 PE=2 SV=1 298 614 8.0E-19
sp|Q54YW1|ELMOA_DICDI ELMO domain-containing protein A OS=Dictyostelium discoideum GN=elmoA PE=1 SV=1 17 368 4.0E-08
sp|Q1ZXK2|FORG_DICDI Formin-G OS=Dictyostelium discoideum GN=forG PE=1 SV=1 15 210 5.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3495
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1809 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7641
Ophiocordyceps camponoti-floridani Ophcf2|00426
Ophiocordyceps camponoti-rufipedis Ophun1|7030
Ophiocordyceps kimflemingae Ophio5|3885
Ophiocordyceps subramaniannii Hirsu2|6676

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1809
MDQADVPVLLSRLSSDDDAGRKMAVFKLQTCINDPAFADVFMSSGGLVVLRRLILDSGGNTLAYSLQSLARLLEL
DMGWDIFRGATSTDLVERVVELIVTNPLVNILRGAMSILVALVSHSQSDTTDTDAVFGFRGLKPAVAVFPQFFEL
VIQQLDSADHALCANALMLINALLRDAVCASPSAPDGAWSNATTGDDWASFVKRLHDLGLVQAVYKLMQSSSIQD
LVHPLLEFQSLSKAIMAKWRQVRVHLGDAQHRRLLKSIHVASAPEANGSLEQWQTQAGPEHHQEHHQEHQPKADM
WRRLGFATESPAQDFEQTGFLGMMDLTDYVGRHEDAFQKLLLEQAAKPVAQRCPIARASLAVTAILYQEFDIDKA
DADDAKGHDGADAKEHDRLFRPLLLQWPRLHTAGLQGFVRIWKATGAEQDDFEKVVQLTRILVEQVVGQASRTRS
IVEVEDEMLEYETARLRQVQMQLLEGAFEATWGRHLDQARQVLKHEALQFVKEQRVRCLLQGAWFTKPSAGGQEH
WRYAKLSHNRRFLHYADFDGRMAQDPGLDSLADKVDLGSISSVVSNVSAPSDEATAQQGAATTKITVYSLGEGGG
EAQEEAVLTLWPTSPSLASEWLDGLLMLLNQAPITAETSKLIDLISDYGLKIRLLNVRLDTAFEGPLPEAGVVPS
REGLDTDYYFDV*
Coding >OphauG2|1809
ATGGACCAAGCAGACGTACCGGTGCTGCTGTCGCGGCTGTCGAGCGACGATGACGCCGGGCGCAAAATGGCCGTG
TTCAAACTGCAGACATGCATCAACGACCCAGCATTTGCCGACGTCTTCATGTCGAGCGGCGGGCTCGTTGTGCTG
CGGCGTCTGATTCTCGACTCGGGCGGCAACACGCTGGCCTACTCGCTGCAAAGCCTTGCTCGCCTGCTGGAGCTG
GACATGGGCTGGGACATATTCCGGGGCGCCACGTCGACGGACCTTGTTGAGCGAGTGGTTGAGCTCATTGTCACC
AATCCCCTGGTTAACATCCTCCGTGGCGCAATGTCCATTCTCGTGGCCCTCGTCAGCCATTCGCAGTCGGACACG
ACCGACACCGACGCCGTCTTTGGCTTCCGCGGCCTCAAGCCCGCCGTTGCCGTCTTTCCACAGTTTTTTGAGCTC
GTCATCCAGCAGCTCGACAGCGCCGACCATGCCCTGTGCGCAAACGCCCTCATGCTCATCAACGCTCTGCTGCGC
GACGCCGTGTGCGCATCGCCCAGTGCCCCCGATGGCGCCTGGAGCAACGCCACGACTGGCGACGACTGGGCCTCT
TTTGTCAAGCGCTTGCACGACTTGGGCCTGGTGCAGGCCGTCTATAAGCTGATGCAGAGCTCTTCCATCCAAGAC
TTGGTCCACCCGCTGCTCGAGTTCCAGTCGCTGAGCAAAGCCATCATGGCGAAATGGCGCCAAGTCAGAGTCCAT
CTTGGCGATGCCCAACACCGCCGCTTGCTCAAGAGCATCCACGTGGCGAGCGCCCCGGAAGCCAATGGCAGCTTG
GAGCAATGGCAGACGCAAGCGGGCCCAGAGCACCACCAAGAGCACCACCAAGAGCACCAGCCCAAGGCTGACATG
TGGAGGCGGCTGGGCTTTGCAACAGAGAGCCCGGCCCAGGACTTTGAGCAGACGGGCTTCCTGGGCATGATGGAC
TTGACCGACTATGTGGGCAGACACGAGGATGCCTTTCAAAAACTGCTGCTCGAGCAGGCGGCCAAGCCCGTGGCC
CAACGCTGTCCCATTGCCCGCGCCAGCCTGGCCGTGACAGCCATTCTCTACCAAGAATTTGACATTGACAAGGCC
GACGCCGACGACGCCAAGGGCCATGACGGCGCCGACGCCAAGGAACACGACCGGCTCTTCCGGCCGCTCTTGCTG
CAATGGCCGCGACTGCACACAGCCGGCCTTCAGGGCTTTGTACGCATATGGAAGGCGACGGGCGCCGAGCAAGAC
GACTTTGAAAAGGTTGTCCAGCTGACACGCATCCTGGTGGAGCAGGTGGTGGGCCAGGCCAGCCGCACACGAAGC
ATTGTCGAGGTGGAGGACGAGATGCTCGAGTACGAGACTGCGCGCCTGCGCCAAGTGCAGATGCAGCTGCTCGAG
GGCGCCTTTGAGGCCACCTGGGGCCGGCACCTGGACCAGGCGCGCCAGGTGCTCAAGCACGAGGCGCTGCAGTTT
GTCAAGGAGCAGCGAGTGCGCTGTCTCCTGCAAGGAGCCTGGTTCACCAAGCCCTCAGCTGGCGGCCAGGAGCAC
TGGAGATATGCCAAGCTGTCGCACAATCGGCGCTTCCTGCACTACGCCGACTTTGACGGGCGCATGGCTCAAGAC
CCCGGGCTCGACAGCCTGGCAGACAAGGTGGACCTGGGCAGCATCAGCTCCGTCGTGTCCAACGTGTCTGCGCCC
AGCGACGAGGCGACGGCGCAGCAGGGCGCAGCAACGACCAAGATTACCGTGTACAGCCTGGGCGAGGGCGGCGGC
GAGGCCCAGGAAGAGGCTGTTTTGACGCTCTGGCCTACAAGTCCCAGCCTGGCGTCGGAGTGGCTCGATGGGCTG
CTGATGCTGCTCAACCAAGCTCCCATAACAGCCGAGACGAGCAAGCTCATTGACCTCATTAGCGACTATGGCTTG
AAGATTCGACTGCTCAATGTGCGTCTGGATACCGCGTTTGAAGGGCCACTGCCAGAGGCGGGCGTGGTGCCGAGC
CGCGAGGGGCTCGATACCGACTATTACTTTGACGTCTAA
Transcript >OphauG2|1809
ATGGACCAAGCAGACGTACCGGTGCTGCTGTCGCGGCTGTCGAGCGACGATGACGCCGGGCGCAAAATGGCCGTG
TTCAAACTGCAGACATGCATCAACGACCCAGCATTTGCCGACGTCTTCATGTCGAGCGGCGGGCTCGTTGTGCTG
CGGCGTCTGATTCTCGACTCGGGCGGCAACACGCTGGCCTACTCGCTGCAAAGCCTTGCTCGCCTGCTGGAGCTG
GACATGGGCTGGGACATATTCCGGGGCGCCACGTCGACGGACCTTGTTGAGCGAGTGGTTGAGCTCATTGTCACC
AATCCCCTGGTTAACATCCTCCGTGGCGCAATGTCCATTCTCGTGGCCCTCGTCAGCCATTCGCAGTCGGACACG
ACCGACACCGACGCCGTCTTTGGCTTCCGCGGCCTCAAGCCCGCCGTTGCCGTCTTTCCACAGTTTTTTGAGCTC
GTCATCCAGCAGCTCGACAGCGCCGACCATGCCCTGTGCGCAAACGCCCTCATGCTCATCAACGCTCTGCTGCGC
GACGCCGTGTGCGCATCGCCCAGTGCCCCCGATGGCGCCTGGAGCAACGCCACGACTGGCGACGACTGGGCCTCT
TTTGTCAAGCGCTTGCACGACTTGGGCCTGGTGCAGGCCGTCTATAAGCTGATGCAGAGCTCTTCCATCCAAGAC
TTGGTCCACCCGCTGCTCGAGTTCCAGTCGCTGAGCAAAGCCATCATGGCGAAATGGCGCCAAGTCAGAGTCCAT
CTTGGCGATGCCCAACACCGCCGCTTGCTCAAGAGCATCCACGTGGCGAGCGCCCCGGAAGCCAATGGCAGCTTG
GAGCAATGGCAGACGCAAGCGGGCCCAGAGCACCACCAAGAGCACCACCAAGAGCACCAGCCCAAGGCTGACATG
TGGAGGCGGCTGGGCTTTGCAACAGAGAGCCCGGCCCAGGACTTTGAGCAGACGGGCTTCCTGGGCATGATGGAC
TTGACCGACTATGTGGGCAGACACGAGGATGCCTTTCAAAAACTGCTGCTCGAGCAGGCGGCCAAGCCCGTGGCC
CAACGCTGTCCCATTGCCCGCGCCAGCCTGGCCGTGACAGCCATTCTCTACCAAGAATTTGACATTGACAAGGCC
GACGCCGACGACGCCAAGGGCCATGACGGCGCCGACGCCAAGGAACACGACCGGCTCTTCCGGCCGCTCTTGCTG
CAATGGCCGCGACTGCACACAGCCGGCCTTCAGGGCTTTGTACGCATATGGAAGGCGACGGGCGCCGAGCAAGAC
GACTTTGAAAAGGTTGTCCAGCTGACACGCATCCTGGTGGAGCAGGTGGTGGGCCAGGCCAGCCGCACACGAAGC
ATTGTCGAGGTGGAGGACGAGATGCTCGAGTACGAGACTGCGCGCCTGCGCCAAGTGCAGATGCAGCTGCTCGAG
GGCGCCTTTGAGGCCACCTGGGGCCGGCACCTGGACCAGGCGCGCCAGGTGCTCAAGCACGAGGCGCTGCAGTTT
GTCAAGGAGCAGCGAGTGCGCTGTCTCCTGCAAGGAGCCTGGTTCACCAAGCCCTCAGCTGGCGGCCAGGAGCAC
TGGAGATATGCCAAGCTGTCGCACAATCGGCGCTTCCTGCACTACGCCGACTTTGACGGGCGCATGGCTCAAGAC
CCCGGGCTCGACAGCCTGGCAGACAAGGTGGACCTGGGCAGCATCAGCTCCGTCGTGTCCAACGTGTCTGCGCCC
AGCGACGAGGCGACGGCGCAGCAGGGCGCAGCAACGACCAAGATTACCGTGTACAGCCTGGGCGAGGGCGGCGGC
GAGGCCCAGGAAGAGGCTGTTTTGACGCTCTGGCCTACAAGTCCCAGCCTGGCGTCGGAGTGGCTCGATGGGCTG
CTGATGCTGCTCAACCAAGCTCCCATAACAGCCGAGACGAGCAAGCTCATTGACCTCATTAGCGACTATGGCTTG
AAGATTCGACTGCTCAATGTGCGTCTGGATACCGCGTTTGAAGGGCCACTGCCAGAGGCGGGCGTGGTGCCGAGC
CGCGAGGGGCTCGATACCGACTATTACTTTGACGTCTAA
Gene >OphauG2|1809
ATGGACCAAGCAGACGTACCGGTGCTGCTGTCGCGGCTGTCGAGCGACGATGACGCCGGGCGCAAAATGGCCGTG
TTCAAACTGCAGACATGCATCAACGACCCAGCATTTGCCGACGTCTTCATGTCGAGCGGCGGGCTCGTTGTGCTG
CGGCGTCTGATTCTCGACTCGGGCGGCAACACGCTGGCCTACTCGCTGCAAAGCCTTGCTCGCCTGCTGGAGCTG
GACATGGGCTGGGACATATTCCGGGGCGCCACGTCGACGGACCTTGTTGAGCGAGTGGTTGAGCTCATTGTCACC
AATCCCCTGGTTAACATCCTCCGTGGCGCAATGTCCATTCTCGTGGCCCTCGTCAGCCATTCGCAGTCGGACACG
ACCGACACCGACGCCGTCTTTGGCTTCCGCGGCCTCAAGCCCGCCGTTGCCGTCTTTCCACAGTTTTTTGAGCTC
GTCATCCAGCAGCTCGACAGCGCCGACCATGCCCTGTGCGCAAACGCCCTCATGCTCATCAACGCTCTGCTGCGC
GACGCCGTGTGCGCATCGCCCAGTGCCCCCGATGGCGCCTGGAGCAACGCCACGACTGGCGACGACTGGGCCTCT
TTTGTCAAGCGCTTGCACGACTTGGGCCTGGTGCAGGCCGTCTATAAGCTGATGCAGAGCTCTTCCATCCAAGAC
TTGGTCCACCCGCTGCTCGAGTTCCAGTCGCTGAGCAAAGCCATCATGGCGAAATGGCGCCAAGTCAGAGTCCAT
CTTGGCGATGCCCAACACCGCCGCTTGCTCAAGAGCATCCACGTGGCGAGCGCCCCGGAAGCCAATGGCAGCTTG
GAGCAATGGCAGACGCAAGCGGGCCCAGAGCACCACCAAGAGCACCACCAAGAGCACCAGCCCAAGGCTGACATG
TGGAGGCGGCTGGGCTTTGCAACAGAGAGCCCGGCCCAGGACTTTGAGCAGACGGGCTTCCTGGGCATGATGGAC
TTGACCGACTATGTGGGCAGACACGAGGATGCCTTTCAAAAACTGCTGCTCGAGCAGGCGGCCAAGCCCGTGGCC
CAACGCTGTCCCATTGCCCGCGCCAGCCTGGCCGTGACAGCCATTCTCTACCAAGAATTTGACATTGACAAGGCC
GACGCCGACGACGCCAAGGGCCATGACGGCGCCGACGCCAAGGAACACGACCGGCTCTTCCGGCCGCTCTTGCTG
CAATGGCCGCGACTGCACACAGCCGGCCTTCAGGGCTTTGTACGCATATGGAAGGCGACGGGCGCCGAGCAAGAC
GACTTTGAAAAGGTTGTCCAGCTGACACGCATCCTGGTGGAGCAGGTGGTGGGCCAGGCCAGCCGCACACGAAGC
ATTGTCGAGGTGGAGGACGAGATGCTCGAGTACGAGACTGCGCGCCTGCGCCAAGTGCAGATGCAGCTGCTCGAG
GGCGCCTTTGAGGCCACCTGGGGCCGGCACCTGGACCAGGCGCGCCAGGTGCTCAAGCACGAGGCGCTGCAGTTT
GTCAAGGAGCAGCGAGTGCGCTGTCTCCTGCAAGGAGCCTGGTTCACCAAGCCCTCAGCTGGCGGCCAGGAGCAC
TGGAGATATGCCAAGCTGTCGCACAATCGGCGCTTCCTGCACTACGCCGACTTTGACGGGCGCATGGCTCAAGAC
CCCGGGCTCGACAGCCTGGCAGACAAGGTGGACCTGGGCAGCATCAGCTCCGTCGTGTCCAACGTGTCTGCGCCC
AGCGACGAGGCGACGGCGCAGCAGGGCGCAGCAACGACCAAGATTACCGTGTACAGCCTGGGCGAGGGCGGCGGC
GAGGCCCAGGAAGAGGCTGTTTTGACGCTCTGGCCTACAAGTCCCAGCCTGGCGTCGGAGTGGCTCGATGGGCTG
CTGATGCTGCTCAACCAAGCTCCCATAACAGCCGAGACGAGCAAGCTCATTGACCTCATTAGCGACTATGGCTTG
AAGATTCGACTGCTCAATGTGCGTCTGGATACCGCGTTTGAAGGGCCACTGCCAGAGGCGGGCGTGGTGCCGAGC
CGCGAGGGGCTCGATACCGACTATTACTTTGACGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail