Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1807
Gene name
LocationContig_1573:996..2190
Strand-
Gene length (bp)1194
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 8.2E-130 1 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1 372 2.0E-137
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1 392 3.0E-137
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1 372 8.0E-124
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 2 373 3.0E-83
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 2 372 4.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 1 372 2.0E-137
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 1 392 3.0E-137
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 1 372 8.0E-124
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 2 373 3.0E-83
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 2 372 4.0E-81
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 2 373 6.0E-81
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 2 372 9.0E-78
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 2 376 1.0E-76
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 2 374 2.0E-76
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 2 376 1.0E-75
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 2 376 2.0E-75
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 2 396 4.0E-75
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 2 376 6.0E-75
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 2 376 2.0E-71
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 2 374 4.0E-70
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 2 374 4.0E-69
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 2 374 8.0E-69
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 2 374 1.0E-67
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 2 371 6.0E-67
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 2 371 1.0E-65
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 2 371 2.0E-65
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 2 374 5.0E-65
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 2 377 2.0E-62
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 2 372 3.0E-62
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 2 377 6.0E-62
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 1 374 1.0E-59
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 2 380 6.0E-57
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 2 375 2.0E-55
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 2 375 4.0E-53
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 2 349 2.0E-50
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 2 374 5.0E-42
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 3 364 7.0E-21
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 3 373 4.0E-20
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 3 349 7.0E-20
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 2 355 1.0E-19
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 3 353 1.0E-18
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 3 227 2.0E-18
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 3 229 8.0E-18
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 3 226 2.0E-17
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 3 349 2.0E-16
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 5 368 4.0E-15
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 2 349 5.0E-15
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 3 102 9.0E-15
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 2 349 2.0E-14
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 5 226 2.0E-14
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 2 341 5.0E-13
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 2 338 7.0E-13
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 2 338 1.0E-12
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 2 338 2.0E-12
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 8 194 5.0E-12
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 2 238 2.0E-11
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 5 341 6.0E-09
sp|Q9SW00|ORP4B_ARATH Oxysterol-binding protein-related protein 4B OS=Arabidopsis thaliana GN=ORP4B PE=2 SV=2 3 349 8.0E-08
sp|Q8MPQ7|OSB1_DICDI Oxysterol-binding protein 1 OS=Dictyostelium discoideum GN=osbA PE=1 SV=1 2 124 1.0E-07
sp|Q9SVZ9|ORP4A_ARATH Oxysterol-binding protein-related protein 4A OS=Arabidopsis thaliana GN=ORP4A PE=2 SV=2 3 349 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008289 lipid binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2018
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1807 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5113
Ophiocordyceps camponoti-floridani Ophcf2|00799
Ophiocordyceps camponoti-rufipedis Ophun1|1903
Ophiocordyceps kimflemingae Ophio5|6744
Ophiocordyceps subramaniannii Hirsu2|2277

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1807
MIGKDMTKMTLPVSFNEPTSLLYRCGEDMEYADLLDLAAERSDSIERLIYVAAFAASEYASTIGRVAKPFNPLLG
ETFEYVRPDKNYRFFIEQVSHHPPVGAAWAESPNWTYWGESAVRSKFYGKSFDINPLGTWFLRLRPKAGGKEDLY
TWKKVTSSVIGIITGSPTVDNYGPMEVKNWTTGEVAQLDFKARGWKASSAYQVSGKIVDKSGQVRVSMGGRWNSR
LYARLTPGFEATVDEGKEGKDCGRLDACGGMTDPSRAYLVWEANGRPKGIPFNLTPFVLTFNHIDDKLRPWLAPT
DSRLRPDQRAMEDGEYDLAATEKNRLEESQRARRRAREAGGHDFVPAWFERARCQVTGEEYWRFTGRYWEQRNKA
GPQGDAGEAWKGLEPIFDDFAA*
Coding >OphauG2|1807
ATGATTGGCAAAGACATGACCAAAATGACGCTGCCCGTGTCCTTTAACGAGCCAACATCACTGCTGTACCGCTGC
GGCGAAGACATGGAGTACGCGGACCTTCTCGACTTGGCGGCGGAGCGCAGCGACTCGATTGAGAGATTGATTTAC
GTTGCGGCGTTTGCAGCCAGCGAGTACGCGTCGACAATTGGGCGGGTGGCCAAGCCCTTTAACCCGCTGTTGGGA
GAGACGTTTGAGTACGTGCGGCCCGACAAGAACTACCGCTTCTTCATCGAGCAGGTTAGCCACCACCCCCCGGTG
GGCGCGGCGTGGGCGGAATCTCCCAACTGGACCTACTGGGGCGAGTCGGCCGTCAGGTCCAAGTTTTACGGCAAG
TCGTTTGATATCAACCCGCTAGGGACGTGGTTCCTCCGGCTGCGGCCCAAGGCGGGGGGCAAGGAGGATTTGTAC
ACGTGGAAAAAGGTGACGTCGTCGGTGATTGGCATCATCACGGGCAGCCCGACGGTGGACAACTATGGGCCGATG
GAGGTGAAGAACTGGACGACGGGCGAGGTGGCGCAGCTCGACTTCAAGGCGCGGGGGTGGAAGGCGTCGAGCGCG
TATCAAGTGTCGGGCAAGATTGTGGACAAGTCGGGCCAGGTGCGGGTCAGCATGGGGGGGCGATGGAACTCGAGG
CTCTATGCGCGGCTGACGCCCGGGTTTGAGGCGACGGTGGACGAGGGCAAAGAGGGCAAAGACTGCGGACGGCTG
GACGCATGTGGCGGCATGACGGATCCCAGCCGGGCGTACCTGGTGTGGGAGGCCAATGGGCGGCCCAAGGGCATC
CCCTTTAACCTGACGCCGTTTGTGCTCACCTTTAACCACATTGACGACAAGCTGCGGCCGTGGCTGGCGCCCACC
GACTCACGGCTGCGGCCCGACCAGCGGGCCATGGAAGACGGCGAATACGACTTGGCGGCCACGGAAAAGAACCGT
CTGGAGGAGAGCCAGCGGGCGCGGCGGCGGGCGCGCGAGGCTGGGGGCCACGACTTTGTTCCGGCGTGGTTTGAG
CGAGCGCGATGCCAAGTGACGGGCGAGGAGTACTGGAGGTTTACCGGCCGGTATTGGGAGCAGCGCAACAAGGCA
GGGCCGCAGGGAGATGCCGGGGAGGCGTGGAAGGGACTGGAGCCCATTTTTGACGATTTTGCGGCATGA
Transcript >OphauG2|1807
ATGATTGGCAAAGACATGACCAAAATGACGCTGCCCGTGTCCTTTAACGAGCCAACATCACTGCTGTACCGCTGC
GGCGAAGACATGGAGTACGCGGACCTTCTCGACTTGGCGGCGGAGCGCAGCGACTCGATTGAGAGATTGATTTAC
GTTGCGGCGTTTGCAGCCAGCGAGTACGCGTCGACAATTGGGCGGGTGGCCAAGCCCTTTAACCCGCTGTTGGGA
GAGACGTTTGAGTACGTGCGGCCCGACAAGAACTACCGCTTCTTCATCGAGCAGGTTAGCCACCACCCCCCGGTG
GGCGCGGCGTGGGCGGAATCTCCCAACTGGACCTACTGGGGCGAGTCGGCCGTCAGGTCCAAGTTTTACGGCAAG
TCGTTTGATATCAACCCGCTAGGGACGTGGTTCCTCCGGCTGCGGCCCAAGGCGGGGGGCAAGGAGGATTTGTAC
ACGTGGAAAAAGGTGACGTCGTCGGTGATTGGCATCATCACGGGCAGCCCGACGGTGGACAACTATGGGCCGATG
GAGGTGAAGAACTGGACGACGGGCGAGGTGGCGCAGCTCGACTTCAAGGCGCGGGGGTGGAAGGCGTCGAGCGCG
TATCAAGTGTCGGGCAAGATTGTGGACAAGTCGGGCCAGGTGCGGGTCAGCATGGGGGGGCGATGGAACTCGAGG
CTCTATGCGCGGCTGACGCCCGGGTTTGAGGCGACGGTGGACGAGGGCAAAGAGGGCAAAGACTGCGGACGGCTG
GACGCATGTGGCGGCATGACGGATCCCAGCCGGGCGTACCTGGTGTGGGAGGCCAATGGGCGGCCCAAGGGCATC
CCCTTTAACCTGACGCCGTTTGTGCTCACCTTTAACCACATTGACGACAAGCTGCGGCCGTGGCTGGCGCCCACC
GACTCACGGCTGCGGCCCGACCAGCGGGCCATGGAAGACGGCGAATACGACTTGGCGGCCACGGAAAAGAACCGT
CTGGAGGAGAGCCAGCGGGCGCGGCGGCGGGCGCGCGAGGCTGGGGGCCACGACTTTGTTCCGGCGTGGTTTGAG
CGAGCGCGATGCCAAGTGACGGGCGAGGAGTACTGGAGGTTTACCGGCCGGTATTGGGAGCAGCGCAACAAGGCA
GGGCCGCAGGGAGATGCCGGGGAGGCGTGGAAGGGACTGGAGCCCATTTTTGACGATTTTGCGGCATGA
Gene >OphauG2|1807
ATGATTGGCAAAGACATGACCAAAATGACGCTGCCCGTGTCCTTTAACGAGCCAACATCACTGCTGTACCGCTGC
GGCGAAGACATGGAGTACGCGGACCTTCTCGACTTGGCGGCGGAGCGCAGCGACTCGATTGAGAGATTGATTTAC
GTTGCGGCGTTTGCAGCCAGCGAGTACGCGTCGACAATTGGGCGGGTGGCCAAGCCCTTTAACCCGCTGTTGGGA
GAGACGTTTGAGTACGTGCGGCCCGACAAGAACTACCGCTTCTTCATCGAGCAGGTTAGCCACCACCCCCCGGTG
GGCGCGGCGTGGGCGGAATCTCCCAACTGGACCTACTGGGGCGAGTCGGCCGTCAGGTCCAAGTTTTACGGCAAG
TCGTTTGATATCAACCCGCTAGGGACGTGGTTCCTCCGGCTGCGGCCCAAGGCGGGGGGCAAGGAGGATTTGTAC
ACGTGGAAAAAGGTGACGTCGTCGGTGATTGGCATCATCACGGGCAGCCCGACGGTGGACAACTATGGGCCGATG
GAGGTGAAGAACTGGACGACGGGCGAGGTGGCGCAGCTCGACTTCAAGGCGCGGGGGTGGAAGGCGTCGAGCGCG
TATCAAGTGTCGGGCAAGATTGTGGACAAGTCGGGCCAGGTGCGGGTCAGCATGGGGGGGCGATGGAACTCGAGG
CTCTATGCGCGGCTGACGCCCGGGTTTGAGGCGACGGTGGACGAGGGCAAAGAGGGCAAAGACTGCGGACGGCTG
GACGCATGTGGCGGCATGACGGATCCCAGCCGGGCGTACCTGGTGTGGGAGGCCAATGGGCGGCCCAAGGGCATC
CCCTTTAACCTGACGCCGTTTGTGCTCACCTTTAACCACATTGACGACAAGCTGCGGCCGTGGCTGGCGCCCACC
GACTCACGGCTGCGGCCCGACCAGCGGGCCATGGAAGACGGCGAATACGACTTGGCGGCCACGGAAAAGAACCGT
CTGGAGGAGAGCCAGCGGGCGCGGCGGCGGGCGCGCGAGGCTGGGGGCCACGACTTTGTTCCGGCGTGGTTTGAG
CGAGCGCGATGCCAAGTGACGGGCGAGGAGTACTGGAGGTTTACCGGCCGGTATTGGGAGCAGCGCAACAAGGCA
GGGCCGCAGGGAGATGCCGGGGAGGCGTGGAAGGGACTGGAGCCCATTTTTGACGATTTTGCGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail