Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1802
Gene name
LocationContig_157:23703..24364
Strand+
Gene length (bp)661
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03645 Tctex-1 Tctex-1 family 1.4E-33 10 147

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5342
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1802 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5263
Ophiocordyceps camponoti-floridani Ophcf2|02105
Ophiocordyceps camponoti-rufipedis Ophun1|1790
Ophiocordyceps kimflemingae Ophio5|3925
Ophiocordyceps subramaniannii Hirsu2|5112

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1802
MTTPPVRPDRLKQIATDACDSAIGKAEFYDHSKTEQWNSTIISSILKAVVAEATPQNASAPSFKFACNSTIVQHL
VPTSSLNKAHGGSEAKVEKSRSEATGTDGKPHVGRRGMHSATGAYWDETKDGMWTFKYEGGEGKGMDVVIMLIWV
AL*
Coding >OphauG2|1802
ATGACTACACCTCCGGTTCGTCCCGATCGACTCAAGCAGATTGCCACCGACGCTTGTGATAGCGCCATTGGTAAA
GCCGAGTTTTACGATCATTCCAAGACTGAACAATGGAACTCGACCATAATTAGCTCAATTCTCAAGGCTGTCGTC
GCAGAAGCAACGCCGCAGAATGCCTCAGCGCCGTCGTTCAAATTTGCCTGCAACAGCACCATTGTACAACACCTC
GTGCCAACATCGTCGCTCAATAAGGCTCATGGAGGCTCTGAAGCCAAGGTTGAAAAATCTCGTTCCGAGGCGACG
GGCACTGACGGGAAGCCACATGTTGGCCGAAGGGGCATGCATAGCGCCACGGGCGCTTACTGGGACGAGACTAAA
GACGGCATGTGGACATTCAAGTATGAGGGAGGAGAGGGTAAGGGTATGGACGTTGTCATTATGCTTATATGGGTT
GCTCTGTGA
Transcript >OphauG2|1802
ATGACTACACCTCCGGTTCGTCCCGATCGACTCAAGCAGATTGCCACCGACGCTTGTGATAGCGCCATTGGTAAA
GCCGAGTTTTACGATCATTCCAAGACTGAACAATGGAACTCGACCATAATTAGCTCAATTCTCAAGGCTGTCGTC
GCAGAAGCAACGCCGCAGAATGCCTCAGCGCCGTCGTTCAAATTTGCCTGCAACAGCACCATTGTACAACACCTC
GTGCCAACATCGTCGCTCAATAAGGCTCATGGAGGCTCTGAAGCCAAGGTTGAAAAATCTCGTTCCGAGGCGACG
GGCACTGACGGGAAGCCACATGTTGGCCGAAGGGGCATGCATAGCGCCACGGGCGCTTACTGGGACGAGACTAAA
GACGGCATGTGGACATTCAAGTATGAGGGAGGAGAGGGTAAGGGTATGGACGTTGTCATTATGCTTATATGGGTT
GCTCTGTGA
Gene >OphauG2|1802
ATGACTACACCTGTACGCGCAGTGTCATGCATCATCTTGCTCGGTATCTGACTTGCCAACAGCCGGTTCGTCCCG
ATCGACTCAAGCAGATTGCCACCGACGTGCGTTGCCCAATCTCCCTGCCTGCCCGATTTCCATGATGGAAAGGGC
TGTCCTGCCGTGTCCTGCAGTCTGACGCGGTGTGTACAGGCTTGTGATAGCGCCATTGGTAAAGCCGAGTTTTAC
GATCATTCCAAGACTGAACAATGGAACTCGACCATAATTGTACGTTGCTGCACTCGACCTGATGTATTCTTGAAA
ACAAGACTAATACATCTTTGAGGGCTAGAGCTCAATTCTCAAGGCTGTCGTCGCAGAAGCAACGCCGCAGAATGC
CTCAGCGCCGTCGTTCAAATTTGCCTGCAACAGCACCATTGTACAACACCTCGTGCCAACATCGTCGCTCAATAA
GGCTCATGGAGGCTCTGAAGCCAAGGTTGAAAAATCTCGTTCCGAGGCGACGGGCACTGACGGGAAGCCACATGT
TGGCCGAAGGGGCATGCATAGCGCCACGGGCGCTTACTGGGACGAGACTAAAGACGGCATGTGGACATTCAAGTA
TGAGGGAGGAGAGGGTAAGGGTATGGACGTTGTCATTATGCTTATATGGGTTGCTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail