Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1796
Gene name
LocationContig_157:11819..13716
Strand-
Gene length (bp)1897
Transcript length (bp)1833
Coding sequence length (bp)1833
Protein length (aa) 611

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 2.4E-01 55 88
PF00400 WD40 WD domain, G-beta repeat 3.0E-02 189 219
PF00400 WD40 WD domain, G-beta repeat 1.8E-05 233 263
PF00400 WD40 WD domain, G-beta repeat 4.5E-03 530 560
PF00400 WD40 WD domain, G-beta repeat 3.4E-02 576 605
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 6.6E-05 459 543

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14301|YE85_SCHPO Uncharacterized WD repeat-containing protein C9G1.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.05 PE=3 SV=1 8 606 6.0E-141
sp|P90587|WD66_PHYPO 66 kDa stress protein OS=Physarum polycephalum PE=2 SV=1 5 608 8.0E-119
sp|P54686|AIP1_DICDI Actin-interacting protein 1 OS=Dictyostelium discoideum GN=aip1 PE=1 SV=2 5 608 2.0E-118
sp|O93277|WDR1_CHICK WD repeat-containing protein 1 OS=Gallus gallus GN=WDR1 PE=2 SV=1 8 606 3.0E-112
sp|Q9VU68|WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster GN=flr PE=2 SV=1 4 609 2.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14301|YE85_SCHPO Uncharacterized WD repeat-containing protein C9G1.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.05 PE=3 SV=1 8 606 6.0E-141
sp|P90587|WD66_PHYPO 66 kDa stress protein OS=Physarum polycephalum PE=2 SV=1 5 608 8.0E-119
sp|P54686|AIP1_DICDI Actin-interacting protein 1 OS=Dictyostelium discoideum GN=aip1 PE=1 SV=2 5 608 2.0E-118
sp|O93277|WDR1_CHICK WD repeat-containing protein 1 OS=Gallus gallus GN=WDR1 PE=2 SV=1 8 606 3.0E-112
sp|Q9VU68|WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster GN=flr PE=2 SV=1 4 609 2.0E-111
sp|Q5RKI0|WDR1_RAT WD repeat-containing protein 1 OS=Rattus norvegicus GN=Wdr1 PE=1 SV=3 8 606 6.0E-111
sp|Q2KJH4|WDR1_BOVIN WD repeat-containing protein 1 OS=Bos taurus GN=WDR1 PE=2 SV=3 8 606 2.0E-110
sp|Q6DIF4|WDR1_XENTR WD repeat-containing protein 1 OS=Xenopus tropicalis GN=wdr1 PE=2 SV=1 8 606 4.0E-110
sp|Q6PAX7|WDR1B_XENLA WD repeat-containing protein 1-B OS=Xenopus laevis GN=wdr1-b PE=2 SV=1 8 606 1.0E-109
sp|O88342|WDR1_MOUSE WD repeat-containing protein 1 OS=Mus musculus GN=Wdr1 PE=1 SV=3 8 606 1.0E-109
sp|O75083|WDR1_HUMAN WD repeat-containing protein 1 OS=Homo sapiens GN=WDR1 PE=1 SV=4 8 606 9.0E-109
sp|Q9W7F2|WDR1A_XENLA WD repeat-containing protein 1-A OS=Xenopus laevis GN=wdr1-a PE=2 SV=2 8 606 5.0E-108
sp|P46680|AIP1_YEAST Actin-interacting protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIP1 PE=1 SV=1 5 606 1.0E-105
sp|Q11176|WDR1_CAEEL Actin-interacting protein 1 OS=Caenorhabditis elegans GN=unc-78 PE=1 SV=1 6 606 1.0E-99
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 54 606 2.0E-26
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 65 606 5.0E-25
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 26 606 2.0E-20
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 59 519 7.0E-19
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 190 605 1.0E-18
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 188 606 2.0E-18
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 55 606 2.0E-17
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 32 521 5.0E-17
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 190 604 2.0E-15
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 190 368 7.0E-15
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 120 608 4.0E-14
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 197 560 4.0E-14
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 32 276 5.0E-14
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 55 359 6.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 60 271 7.0E-14
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 50 355 9.0E-14
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 181 360 4.0E-13
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 180 404 4.0E-13
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 59 360 1.0E-12
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 197 560 1.0E-12
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 146 358 2.0E-12
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 154 560 3.0E-12
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 190 605 4.0E-12
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 49 355 4.0E-12
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 49 366 4.0E-12
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 190 606 9.0E-12
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 142 398 1.0E-11
sp|O13982|YEC8_SCHPO Uncharacterized WD repeat-containing protein C25H1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25H1.08c PE=3 SV=1 59 265 2.0E-11
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 189 406 2.0E-11
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 59 359 3.0E-11
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 41 355 3.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 38 274 4.0E-11
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 190 406 4.0E-11
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 190 606 4.0E-11
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 190 389 4.0E-11
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 59 329 5.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 146 360 7.0E-11
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 146 360 7.0E-11
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 146 360 7.0E-11
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 146 360 7.0E-11
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 190 406 8.0E-11
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 190 406 8.0E-11
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 190 406 8.0E-11
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 57 521 9.0E-11
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 146 360 9.0E-11
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 190 406 9.0E-11
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 32 262 1.0E-10
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 59 329 1.0E-10
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 59 329 1.0E-10
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 59 329 1.0E-10
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 59 329 1.0E-10
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 190 406 1.0E-10
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 189 513 1.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 197 560 1.0E-10
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 142 360 1.0E-10
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 59 359 1.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 30 365 2.0E-10
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 190 399 2.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 58 262 2.0E-10
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 144 383 2.0E-10
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 171 404 3.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 165 321 3.0E-10
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 44 355 3.0E-10
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 59 344 3.0E-10
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 189 360 3.0E-10
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 18 262 4.0E-10
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 190 604 4.0E-10
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 49 397 4.0E-10
sp|O94620|CWF17_SCHPO Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 42 264 4.0E-10
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 190 406 4.0E-10
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 22 263 4.0E-10
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 34 321 5.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 190 406 5.0E-10
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 27 331 6.0E-10
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 144 360 6.0E-10
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 27 331 6.0E-10
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 190 406 6.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 58 262 6.0E-10
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 34 321 6.0E-10
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 137 357 7.0E-10
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 59 273 7.0E-10
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 34 321 7.0E-10
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 156 266 7.0E-10
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 32 355 7.0E-10
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 59 610 8.0E-10
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 197 537 8.0E-10
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 190 606 8.0E-10
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 190 605 9.0E-10
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 58 262 9.0E-10
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 34 321 9.0E-10
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 22 263 1.0E-09
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 190 605 1.0E-09
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 197 537 1.0E-09
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 234 605 1.0E-09
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 7 264 1.0E-09
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 26 355 1.0E-09
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 141 408 1.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 146 360 2.0E-09
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 59 348 2.0E-09
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 48 355 2.0E-09
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 49 355 2.0E-09
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 194 355 2.0E-09
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 194 355 2.0E-09
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 7 264 2.0E-09
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 234 605 3.0E-09
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 146 560 3.0E-09
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 59 263 3.0E-09
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 56 355 3.0E-09
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 55 378 4.0E-09
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 146 560 4.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 58 262 4.0E-09
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 161 324 4.0E-09
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 58 342 4.0E-09
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 188 480 4.0E-09
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 144 412 4.0E-09
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 319 604 5.0E-09
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 32 355 5.0E-09
sp|Q55FJ2|WDR91_DICDI WD repeat-containing protein 91 homolog OS=Dictyostelium discoideum GN=wdr91 PE=3 SV=1 44 352 5.0E-09
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 59 268 5.0E-09
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 193 358 6.0E-09
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 146 560 7.0E-09
sp|Q9JJ66|CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus GN=Cdc20 PE=1 SV=2 375 604 8.0E-09
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 375 604 9.0E-09
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 59 263 9.0E-09
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 51 359 1.0E-08
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 56 349 1.0E-08
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 142 401 1.0E-08
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 142 401 1.0E-08
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 142 401 1.0E-08
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 142 401 1.0E-08
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 142 401 1.0E-08
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 142 401 1.0E-08
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 142 401 1.0E-08
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 142 412 1.0E-08
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 57 269 2.0E-08
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 190 367 2.0E-08
sp|P93397|GBB1_TOBAC Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1 220 560 2.0E-08
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 60 378 2.0E-08
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 59 310 2.0E-08
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 53 263 2.0E-08
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 142 441 2.0E-08
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 57 271 3.0E-08
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 144 389 3.0E-08
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 59 310 3.0E-08
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 180 406 3.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 234 560 4.0E-08
sp|Q9DAJ4|WDR83_MOUSE WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 191 430 4.0E-08
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 190 389 4.0E-08
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 225 541 4.0E-08
sp|Q5BLX8|WDR83_RAT WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 191 430 4.0E-08
sp|Q8L4J2|CTF50_ARATH Cleavage stimulation factor subunit 50 OS=Arabidopsis thaliana GN=CSTF50 PE=1 SV=1 53 286 5.0E-08
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 56 349 5.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 26 266 6.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 319 606 6.0E-08
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 188 267 6.0E-08
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 69 267 6.0E-08
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 142 360 6.0E-08
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 189 362 6.0E-08
sp|P93563|GBB_SOLTU Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 220 560 6.0E-08
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 57 271 7.0E-08
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 189 362 7.0E-08
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 455 606 7.0E-08
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 455 606 7.0E-08
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 205 560 8.0E-08
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 205 560 8.0E-08
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 205 560 8.0E-08
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 205 560 8.0E-08
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 146 391 8.0E-08
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 45 266 8.0E-08
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 51 282 9.0E-08
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 139 360 9.0E-08
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 455 604 9.0E-08
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 455 606 9.0E-08
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 38 277 1.0E-07
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 32 271 1.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 158 521 1.0E-07
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 189 362 1.0E-07
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 63 219 1.0E-07
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 189 362 1.0E-07
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 189 363 1.0E-07
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 189 363 1.0E-07
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 234 541 1.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 155 266 2.0E-07
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 59 274 2.0E-07
sp|P26308|GBB1_DROME Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 220 560 2.0E-07
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 220 560 2.0E-07
sp|Q6PH57|GBB1_DANRE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 190 395 2.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 59 317 2.0E-07
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 68 368 2.0E-07
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 225 541 2.0E-07
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 225 541 2.0E-07
sp|Q09990|LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 202 400 2.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 189 363 2.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 137 262 3.0E-07
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 190 403 3.0E-07
sp|Q5FVN8|WSDU1_RAT WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 57 271 3.0E-07
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 452 608 3.0E-07
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 59 308 3.0E-07
sp|Q54Y96|SMU1_DICDI WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 182 360 3.0E-07
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 189 362 3.0E-07
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 190 267 3.0E-07
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 375 604 3.0E-07
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 57 274 4.0E-07
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 190 397 4.0E-07
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 193 357 4.0E-07
sp|P74598|Y1491_SYNY3 Uncharacterized WD repeat-containing protein sll1491 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1491 PE=3 SV=1 190 357 4.0E-07
sp|Q99973|TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2 190 540 4.0E-07
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 455 606 4.0E-07
sp|Q9HAV0|GBB4_HUMAN Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 220 560 4.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 59 274 5.0E-07
sp|Q803V5|LST8_DANRE Target of rapamycin complex subunit lst8 OS=Danio rerio GN=mlst8 PE=2 SV=1 18 267 5.0E-07
sp|Q7ZWF0|RAE1L_DANRE mRNA export factor OS=Danio rerio GN=rae1 PE=2 SV=2 190 352 5.0E-07
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 146 263 5.0E-07
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 68 297 5.0E-07
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 455 606 6.0E-07
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 455 606 6.0E-07
sp|Q9SZQ5|VIP3_ARATH WD repeat-containing protein VIP3 OS=Arabidopsis thaliana GN=VIP3 PE=1 SV=1 35 263 6.0E-07
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 65 360 6.0E-07
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 139 360 6.0E-07
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 139 360 6.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 455 609 6.0E-07
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 50 508 7.0E-07
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 190 395 7.0E-07
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 10 263 7.0E-07
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 57 274 8.0E-07
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 225 541 8.0E-07
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 426 607 9.0E-07
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 426 607 9.0E-07
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 146 360 9.0E-07
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 190 378 1.0E-06
sp|Q1LV15|DAW1_DANRE Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 57 262 1.0E-06
sp|Q54LT8|STRAP_DICDI Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 202 360 1.0E-06
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 48 357 1.0E-06
sp|O16519|GAD1_CAEEL Gastrulation defective protein 1 OS=Caenorhabditis elegans GN=gad-1 PE=1 SV=1 51 265 1.0E-06
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 68 297 1.0E-06
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 65 360 1.0E-06
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 68 297 1.0E-06
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 24 265 1.0E-06
sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 142 360 1.0E-06
sp|Q05946|UTP13_YEAST U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 190 355 1.0E-06
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 54 317 1.0E-06
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 234 541 1.0E-06
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 45 358 1.0E-06
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 24 265 1.0E-06
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 190 397 1.0E-06
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 24 265 1.0E-06
sp|Q6BSL7|EIF3I_DEBHA Eukaryotic translation initiation factor 3 subunit I OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF34 PE=3 SV=1 190 360 1.0E-06
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 48 357 1.0E-06
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 198 395 1.0E-06
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 137 378 2.0E-06
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 408 605 2.0E-06
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 144 263 2.0E-06
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 206 560 2.0E-06
sp|A9V790|LIS1_MONBE Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 224 560 2.0E-06
sp|P54313|GBB2_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 190 395 2.0E-06
sp|P62880|GBB2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 190 395 2.0E-06
sp|P62879|GBB2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 190 395 2.0E-06
sp|P11017|GBB2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 190 395 2.0E-06
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 456 603 2.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 58 262 2.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 183 358 2.0E-06
sp|Q5ZL33|STRAP_CHICK Serine-threonine kinase receptor-associated protein OS=Gallus gallus GN=STRAP PE=2 SV=2 190 360 2.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 146 414 2.0E-06
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 48 357 2.0E-06
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 190 395 2.0E-06
sp|P52287|GBB3_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 182 356 2.0E-06
sp|P16520|GBB3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 110 356 2.0E-06
sp|Q5B8Y3|EIF3I_EMENI Eukaryotic translation initiation factor 3 subunit I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif34 PE=3 SV=1 199 360 2.0E-06
sp|P41838|RAE1_SCHPO Poly(A)+ RNA export protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rae1 PE=1 SV=1 128 386 2.0E-06
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 234 541 2.0E-06
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 182 359 2.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 190 397 2.0E-06
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 426 607 2.0E-06
sp|Q86TI4|WDR86_HUMAN WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 20 377 2.0E-06
sp|O13286|SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srw1 PE=1 SV=1 470 605 2.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 190 397 2.0E-06
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 76 297 2.0E-06
sp|Q5SRY7|FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 188 400 2.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 142 360 2.0E-06
sp|Q7KWL3|DCA13_DICDI DDB1- and CUL4-associated factor 13 OS=Dictyostelium discoideum GN=wdsof1 PE=3 SV=1 139 270 2.0E-06
sp|Q61011|GBB3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 182 356 2.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 188 518 2.0E-06
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 76 297 2.0E-06
sp|Q9UKB1|FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 188 400 2.0E-06
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 190 338 2.0E-06
sp|O45040|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 220 560 3.0E-06
sp|Q54LT8|STRAP_DICDI Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 60 262 3.0E-06
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 194 356 3.0E-06
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 65 360 3.0E-06
sp|O74184|WAT1_SCHPO WD repeat-containing protein wat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wat1 PE=1 SV=1 28 286 3.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 190 397 3.0E-06
sp|O15736|TIPD_DICDI Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 119 372 3.0E-06
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 59 308 3.0E-06
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 146 273 3.0E-06
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 190 385 3.0E-06
sp|Q9Z1Z2|STRAP_MOUSE Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 190 360 3.0E-06
sp|Q9FUY2|LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana GN=LUG PE=1 SV=2 194 324 3.0E-06
sp|Q40687|GBB_ORYSJ Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=RGB1 PE=1 SV=1 146 391 3.0E-06
sp|B8AP31|GBB_ORYSI Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. indica GN=RGBB PE=2 SV=1 146 391 3.0E-06
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 76 297 3.0E-06
sp|Q9BRX9|WDR83_HUMAN WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 191 406 3.0E-06
sp|P17343|GBB1_CAEEL Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 182 560 3.0E-06
sp|Q61ZF6|GBB1_CAEBR Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 182 560 3.0E-06
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 493 607 4.0E-06
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 224 520 4.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 320 604 4.0E-06
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 131 356 4.0E-06
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 24 265 4.0E-06
sp|Q08706|GBB_LYMST Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 220 560 4.0E-06
sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 493 607 4.0E-06
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 136 338 4.0E-06
sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 55 361 4.0E-06
sp|O24076|GBLP_MEDSA Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 142 360 4.0E-06
sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 55 361 4.0E-06
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 136 370 4.0E-06
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 136 370 4.0E-06
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 142 360 4.0E-06
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 59 306 4.0E-06
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 131 356 5.0E-06
sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 456 609 5.0E-06
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 2 358 5.0E-06
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 45 358 5.0E-06
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 45 358 5.0E-06
sp|Q9USN3|UTP13_SCHPO Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 26 604 5.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 55 271 5.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 58 263 5.0E-06
sp|P23232|GBB_LOLFO Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 220 560 5.0E-06
sp|Q5GIS3|GBB_PINFU Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 190 395 5.0E-06
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 190 266 5.0E-06
sp|Q9GL51|LIS1_PIG Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 48 357 5.0E-06
sp|B7PS00|LIS1_IXOSC Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 48 272 5.0E-06
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 182 359 5.0E-06
sp|Q3SZD4|WDR18_BOVIN WD repeat-containing protein 18 OS=Bos taurus GN=WDR18 PE=2 SV=1 249 381 5.0E-06
sp|P40217|EIF3I_YEAST Eukaryotic translation initiation factor 3 subunit I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF34 PE=1 SV=1 186 377 5.0E-06
sp|A6ZMK5|EIF3I_YEAS7 Eukaryotic translation initiation factor 3 subunit I OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF34 PE=3 SV=1 186 377 5.0E-06
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 182 359 5.0E-06
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 182 359 5.0E-06
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 182 359 5.0E-06
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 182 359 5.0E-06
sp|Q5E959|STRAP_BOVIN Serine-threonine kinase receptor-associated protein OS=Bos taurus GN=STRAP PE=2 SV=1 190 305 5.0E-06
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 186 406 5.0E-06
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 60 273 6.0E-06
sp|E3LB80|EIF3I_PUCGT Eukaryotic translation initiation factor 3 subunit I OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=TIF34 PE=3 SV=2 190 414 6.0E-06
sp|Q9Y3F4|STRAP_HUMAN Serine-threonine kinase receptor-associated protein OS=Homo sapiens GN=STRAP PE=1 SV=1 190 305 6.0E-06
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 188 360 6.0E-06
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 234 552 6.0E-06
sp|Q7K4B3|ELP2_DROME Probable elongator complex protein 2 OS=Drosophila melanogaster GN=Elp2 PE=1 SV=1 115 328 6.0E-06
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 68 297 6.0E-06
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 493 607 6.0E-06
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 153 320 7.0E-06
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 49 263 7.0E-06
sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 493 607 7.0E-06
sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 493 607 7.0E-06
sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 493 607 7.0E-06
sp|Q76B40|SMU1_CRIGR WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 493 607 7.0E-06
sp|Q2TBS9|SMU1_BOVIN WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 493 607 7.0E-06
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 182 359 7.0E-06
sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 493 607 7.0E-06
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 48 357 7.0E-06
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 452 604 7.0E-06
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 456 606 7.0E-06
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 146 332 8.0E-06
sp|Q40507|GBB3_TOBAC Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1 146 391 8.0E-06
sp|Q5AI86|EIF3I_CANAL Eukaryotic translation initiation factor 3 subunit I OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF34 PE=3 SV=1 190 360 8.0E-06
sp|Q8W117|SMU1_ARATH Suppressor of mec-8 and unc-52 protein homolog 1 OS=Arabidopsis thaliana GN=SMU1 PE=1 SV=1 190 360 8.0E-06
sp|Q93794|SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 41 271 8.0E-06
sp|P41838|RAE1_SCHPO Poly(A)+ RNA export protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rae1 PE=1 SV=1 474 607 9.0E-06
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 69 268 9.0E-06
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 193 357 9.0E-06
sp|Q5XIG8|STRAP_RAT Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus GN=Strap PE=1 SV=1 190 360 9.0E-06
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 190 271 1.0E-05
sp|Q6P4J8|SMU1_XENTR WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 182 359 1.0E-05
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 48 357 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1796
MASPSISISKIFAAVPTTVRGQPSQLSADSKGQRIAYASAKSILVRSIDNPADCKEYTGHTAPTTVARFAPNGFK
IASGDSSGILRVWEPETIDATRGEYPIVSGRLNDIAWDGESQRLIAVGHGKELYGRCITADSGNSVGEVIGHSKS
VNAVAIKPQRPFRAATVADDGNMVFYHGAPYKFNDKSTQHRGFVLGAAYSPDGNTLVTVGADKTIQLYDGKTGQP
TKQIGQGEHTGSIFSVAWSQDSKRFATASADQTVKLWDADTGSPIQTWKFGQGVSIRDQQVGVVIPHGRNDGLII
SINLDGELIYLSQGKNEPLRVIQGHNRAITAMTASSDGKGDSIWTGSFDGRVCSWDVETGLASTVDGEPHTNRIA
QLAGLSGKIYSAGWDDKLKIVDESAKTFLGQALTLPAQPKDASTSESAVYIATISSVAAYANGELLKETSLDYSP
GAIAASGSLVAIGADQNSVRIYQADGSGNLKQMQSIQNPTGTISALSFSKDGSHLAAGNSVGKIYVYKTDTWDLA
ADRWSAHTGRVMCISWEDSGAYAASGSLDTHVFVWCLEAKNQGKRIKAANAHKDGVYGIRWVSQGRVASAGGDAT
VKLWNVKNLP*
Coding >OphauG2|1796
ATGGCATCGCCCTCTATTTCCATCAGCAAAATCTTTGCCGCTGTTCCTACCACCGTCAGGGGCCAGCCCTCCCAG
CTGTCGGCTGATTCCAAAGGCCAGCGAATAGCCTACGCGTCTGCAAAGTCCATTCTTGTCCGCTCCATTGACAAC
CCCGCCGACTGTAAAGAATACACGGGCCACACTGCCCCAACCACAGTCGCCCGCTTCGCCCCTAATGGCTTCAAG
ATTGCCAGCGGCGACTCGAGCGGCATCCTGCGCGTCTGGGAGCCAGAGACGATTGACGCTACCAGGGGCGAATAC
CCCATCGTCTCGGGACGCCTCAACGACATTGCCTGGGACGGCGAGTCGCAGCGTCTCATAGCCGTCGGCCATGGC
AAGGAGCTCTATGGCCGCTGCATCACGGCCGATAGCGGCAACTCGGTCGGCGAAGTAATCGGCCATTCCAAGTCG
GTCAATGCTGTTGCAATAAAACCCCAGCGCCCCTTCCGAGCCGCCACTGTTGCTGACGATGGCAACATGGTCTTT
TATCACGGTGCCCCCTACAAGTTCAACGACAAGAGCACCCAACACAGAGGCTTTGTCCTGGGCGCTGCCTATTCC
CCGGACGGCAACACCTTGGTGACTGTGGGTGCTGATAAAACAATACAGCTATATGATGGAAAGACGGGCCAGCCC
ACCAAGCAGATTGGCCAAGGCGAGCACACGGGAAGCATCTTTTCCGTCGCATGGTCCCAAGACAGCAAGCGCTTC
GCCACAGCCAGTGCAGATCAGACTGTCAAACTGTGGGATGCAGACACGGGCTCACCCATCCAGACCTGGAAGTTT
GGTCAAGGCGTCAGTATCAGGGATCAGCAAGTTGGAGTCGTCATCCCTCACGGCCGAAATGACGGTCTCATCATC
AGCATCAACCTCGATGGCGAGCTCATATATCTCAGTCAAGGAAAGAATGAGCCCCTGAGAGTCATACAAGGGCAC
AACAGAGCAATCACTGCCATGACTGCTTCGTCAGATGGCAAGGGCGACAGCATCTGGACTGGTAGCTTTGACGGA
AGGGTCTGCAGTTGGGACGTTGAGACAGGACTCGCTTCAACAGTCGACGGCGAGCCTCATACCAACCGAATAGCC
CAATTGGCTGGGCTCTCGGGAAAGATTTACAGTGCTGGTTGGGACGACAAGCTCAAGATTGTCGACGAGTCAGCC
AAGACATTTTTGGGCCAGGCCCTCACACTTCCCGCGCAGCCCAAGGACGCCAGCACGTCTGAAAGTGCCGTCTAC
ATTGCCACCATTTCTAGCGTCGCGGCATATGCCAATGGGGAGCTGCTCAAAGAGACCAGCTTAGACTATAGTCCC
GGAGCAATTGCCGCCTCTGGCTCGCTTGTGGCAATTGGTGCCGACCAAAACTCGGTGCGTATATACCAGGCTGAT
GGCAGCGGCAATTTGAAACAGATGCAATCCATACAGAACCCAACAGGCACCATCTCGGCCCTTTCATTTTCCAAG
GACGGCTCACATCTCGCCGCCGGCAACAGCGTCGGCAAGATTTATGTCTACAAGACAGATACGTGGGACCTTGCC
GCTGATAGATGGTCGGCACACACTGGCCGCGTCATGTGTATATCCTGGGAAGACAGTGGCGCCTACGCTGCCAGT
GGGAGCCTCGATACGCACGTCTTTGTCTGGTGCTTGGAAGCCAAGAACCAGGGCAAGAGAATCAAGGCTGCAAAT
GCTCACAAGGATGGCGTCTACGGCATACGCTGGGTGTCACAGGGACGAGTGGCCAGTGCTGGAGGGGATGCAACC
GTCAAGCTGTGGAATGTCAAGAACTTACCATGA
Transcript >OphauG2|1796
ATGGCATCGCCCTCTATTTCCATCAGCAAAATCTTTGCCGCTGTTCCTACCACCGTCAGGGGCCAGCCCTCCCAG
CTGTCGGCTGATTCCAAAGGCCAGCGAATAGCCTACGCGTCTGCAAAGTCCATTCTTGTCCGCTCCATTGACAAC
CCCGCCGACTGTAAAGAATACACGGGCCACACTGCCCCAACCACAGTCGCCCGCTTCGCCCCTAATGGCTTCAAG
ATTGCCAGCGGCGACTCGAGCGGCATCCTGCGCGTCTGGGAGCCAGAGACGATTGACGCTACCAGGGGCGAATAC
CCCATCGTCTCGGGACGCCTCAACGACATTGCCTGGGACGGCGAGTCGCAGCGTCTCATAGCCGTCGGCCATGGC
AAGGAGCTCTATGGCCGCTGCATCACGGCCGATAGCGGCAACTCGGTCGGCGAAGTAATCGGCCATTCCAAGTCG
GTCAATGCTGTTGCAATAAAACCCCAGCGCCCCTTCCGAGCCGCCACTGTTGCTGACGATGGCAACATGGTCTTT
TATCACGGTGCCCCCTACAAGTTCAACGACAAGAGCACCCAACACAGAGGCTTTGTCCTGGGCGCTGCCTATTCC
CCGGACGGCAACACCTTGGTGACTGTGGGTGCTGATAAAACAATACAGCTATATGATGGAAAGACGGGCCAGCCC
ACCAAGCAGATTGGCCAAGGCGAGCACACGGGAAGCATCTTTTCCGTCGCATGGTCCCAAGACAGCAAGCGCTTC
GCCACAGCCAGTGCAGATCAGACTGTCAAACTGTGGGATGCAGACACGGGCTCACCCATCCAGACCTGGAAGTTT
GGTCAAGGCGTCAGTATCAGGGATCAGCAAGTTGGAGTCGTCATCCCTCACGGCCGAAATGACGGTCTCATCATC
AGCATCAACCTCGATGGCGAGCTCATATATCTCAGTCAAGGAAAGAATGAGCCCCTGAGAGTCATACAAGGGCAC
AACAGAGCAATCACTGCCATGACTGCTTCGTCAGATGGCAAGGGCGACAGCATCTGGACTGGTAGCTTTGACGGA
AGGGTCTGCAGTTGGGACGTTGAGACAGGACTCGCTTCAACAGTCGACGGCGAGCCTCATACCAACCGAATAGCC
CAATTGGCTGGGCTCTCGGGAAAGATTTACAGTGCTGGTTGGGACGACAAGCTCAAGATTGTCGACGAGTCAGCC
AAGACATTTTTGGGCCAGGCCCTCACACTTCCCGCGCAGCCCAAGGACGCCAGCACGTCTGAAAGTGCCGTCTAC
ATTGCCACCATTTCTAGCGTCGCGGCATATGCCAATGGGGAGCTGCTCAAAGAGACCAGCTTAGACTATAGTCCC
GGAGCAATTGCCGCCTCTGGCTCGCTTGTGGCAATTGGTGCCGACCAAAACTCGGTGCGTATATACCAGGCTGAT
GGCAGCGGCAATTTGAAACAGATGCAATCCATACAGAACCCAACAGGCACCATCTCGGCCCTTTCATTTTCCAAG
GACGGCTCACATCTCGCCGCCGGCAACAGCGTCGGCAAGATTTATGTCTACAAGACAGATACGTGGGACCTTGCC
GCTGATAGATGGTCGGCACACACTGGCCGCGTCATGTGTATATCCTGGGAAGACAGTGGCGCCTACGCTGCCAGT
GGGAGCCTCGATACGCACGTCTTTGTCTGGTGCTTGGAAGCCAAGAACCAGGGCAAGAGAATCAAGGCTGCAAAT
GCTCACAAGGATGGCGTCTACGGCATACGCTGGGTGTCACAGGGACGAGTGGCCAGTGCTGGAGGGGATGCAACC
GTCAAGCTGTGGAATGTCAAGAACTTACCATGA
Gene >OphauG2|1796
ATGGCATCGCCCTCTATTTCCATCAGCAAAATCTTTGCCGCTGTTCCTACCACCGTCAGGGGCCAGCCCTCCCAG
CTGTCGGCTGATTCCAAAGGCCAGCGAATAGCCTACGCGGTCAGCTCCCATGCCCTGTCTCTCCCCTCCATCATG
CTGCCTCTGACATGAGACGCTGCTCCAGTCTGCAAAGTCCATTCTTGTCCGCTCCATTGACAACCCCGCCGACTG
TAAAGAATACACGGGCCACACTGCCCCAACCACAGTCGCCCGCTTCGCCCCTAATGGCTTCAAGATTGCCAGCGG
CGACTCGAGCGGCATCCTGCGCGTCTGGGAGCCAGAGACGATTGACGCTACCAGGGGCGAATACCCCATCGTCTC
GGGACGCCTCAACGACATTGCCTGGGACGGCGAGTCGCAGCGTCTCATAGCCGTCGGCCATGGCAAGGAGCTCTA
TGGCCGCTGCATCACGGCCGATAGCGGCAACTCGGTCGGCGAAGTAATCGGCCATTCCAAGTCGGTCAATGCTGT
TGCAATAAAACCCCAGCGCCCCTTCCGAGCCGCCACTGTTGCTGACGATGGCAACATGGTCTTTTATCACGGTGC
CCCCTACAAGTTCAACGACAAGAGCACCCAACACAGAGGCTTTGTCCTGGGCGCTGCCTATTCCCCGGACGGCAA
CACCTTGGTGACTGTGGGTGCTGATAAAACAATACAGCTATATGATGGAAAGACGGGCCAGCCCACCAAGCAGAT
TGGCCAAGGCGAGCACACGGGAAGCATCTTTTCCGTCGCATGGTCCCAAGACAGCAAGCGCTTCGCCACAGCCAG
TGCAGATCAGACTGTCAAACTGTGGGATGCAGACACGGGCTCACCCATCCAGACCTGGAAGTTTGGTCAAGGCGT
CAGTATCAGGGATCAGCAAGTTGGAGTCGTCATCCCTCACGGCCGAAATGACGGTCTCATCATCAGCATCAACCT
CGATGGCGAGCTCATATATCTCAGTCAAGGAAAGAATGAGCCCCTGAGAGTCATACAAGGGCACAACAGAGCAAT
CACTGCCATGACTGCTTCGTCAGATGGCAAGGGCGACAGCATCTGGACTGGTAGCTTTGACGGAAGGGTCTGCAG
TTGGGACGTTGAGACAGGACTCGCTTCAACAGTCGACGGCGAGCCTCATACCAACCGAATAGCCCAATTGGCTGG
GCTCTCGGGAAAGATTTACAGTGCTGGTTGGGACGACAAGCTCAAGATTGTCGACGAGTCAGCCAAGACATTTTT
GGGCCAGGCCCTCACACTTCCCGCGCAGCCCAAGGACGCCAGCACGTCTGAAAGTGCCGTCTACATTGCCACCAT
TTCTAGCGTCGCGGCATATGCCAATGGGGAGCTGCTCAAAGAGACCAGCTTAGACTATAGTCCCGGAGCAATTGC
CGCCTCTGGCTCGCTTGTGGCAATTGGTGCCGACCAAAACTCGGTGCGTATATACCAGGCTGATGGCAGCGGCAA
TTTGAAACAGATGCAATCCATACAGAACCCAACAGGCACCATCTCGGCCCTTTCATTTTCCAAGGACGGCTCACA
TCTCGCCGCCGGCAACAGCGTCGGCAAGATTTATGTCTACAAGACAGATACGTGGGACCTTGCCGCTGATAGATG
GTCGGCACACACTGGCCGCGTCATGTGTATATCCTGGGAAGACAGTGGCGCCTACGCTGCCAGTGGGAGCCTCGA
TACGCACGTCTTTGTCTGGTGCTTGGAAGCCAAGAACCAGGGCAAGAGAATCAAGGCTGCAAATGCTCACAAGGA
TGGCGTCTACGGCATACGCTGGGTGTCACAGGGACGAGTGGCCAGTGCTGGAGGGGATGCAACCGTCAAGCTGTG
GAATGTCAAGAACTTACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail