Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1788
Gene name
LocationContig_1569:1844..2801
Strand+
Gene length (bp)957
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04909 Amidohydro_2 Amidohydrolase 2.6E-25 41 318

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q93PS7|PDCH_COMTE 2-pyrone-4,6-dicarbaxylate hydrolase OS=Comamonas testosteroni PE=3 SV=1 27 278 1.0E-20
sp|O87170|PDCH_SPHPI 2-pyrone-4,6-dicarbaxylate hydrolase OS=Sphingomonas paucimobilis GN=ligI PE=1 SV=1 35 282 3.0E-18
sp|A6XIG6|SLMH_HYDIT 4-sulfomuconolactone hydrolase OS=Hydrogenophaga intermedia PE=1 SV=1 40 281 1.0E-15
sp|A6XIG7|SLMH_RHIRD 4-sulfomuconolactone hydrolase OS=Rhizobium radiobacter PE=1 SV=1 40 281 1.0E-13

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1788
MAAVLVLALLGLAWTWILDSAPSLPLPSTSSSSWPAATGWDSHMHLINTQRFPASADAVYQPRRRDNATDAALFE
ASIGCQALTVVQPSIYANDNALLLETLGALGLGRARGVVVFDAQTTPRATLQQWHRAGVRGARLNLRSANKTLAP
DVLARRLTRYADALRPLGWALQLYVAMDALPAVESVIARLGVRVVLDHLGSPKMPPWWPTDAARDPYSIGGFGAM
MRLLQGNSTWVKISGPYRCSQAPAPLWRDLDPLIDELLRRVPGKVLYGTDWPHTRFEGLDIGPWTRRLEQRAGER
NATVRNGLFGDNAQRFWR*
Coding >OphauG2|1788
ATGGCGGCAGTGCTGGTGCTGGCTTTGCTTGGCCTCGCATGGACTTGGATTCTCGACTCGGCCCCGTCGCTGCCT
CTGCCGTCGACTTCAAGCTCGTCTTGGCCGGCGGCGACGGGCTGGGACTCGCACATGCACCTCATCAACACGCAG
CGCTTCCCCGCCAGCGCAGATGCAGTCTACCAGCCCCGACGCCGCGACAACGCGACCGACGCCGCACTGTTTGAA
GCCAGCATTGGCTGCCAGGCCCTGACGGTGGTGCAGCCGTCGATATACGCCAACGACAACGCGCTGCTTCTCGAG
ACGCTCGGGGCGCTGGGGCTGGGCCGGGCTCGCGGCGTCGTGGTGTTTGATGCGCAAACGACGCCCAGGGCCACG
CTGCAGCAGTGGCACCGGGCGGGCGTGCGAGGGGCGCGGCTGAATCTGCGCAGCGCAAACAAGACGCTGGCGCCA
GACGTGCTGGCCCGGCGGCTCACGAGGTATGCGGATGCCCTCCGGCCGCTGGGCTGGGCGCTGCAGCTGTACGTG
GCCATGGACGCGCTGCCGGCGGTCGAGTCGGTGATTGCGCGTCTGGGCGTGCGCGTGGTGCTGGACCACTTGGGA
AGCCCCAAGATGCCGCCGTGGTGGCCAACAGACGCGGCGCGCGATCCATACTCGATTGGCGGCTTTGGGGCCATG
ATGCGGCTGCTGCAGGGTAACAGCACCTGGGTCAAGATTTCAGGGCCCTATCGCTGCTCCCAGGCGCCTGCGCCG
CTGTGGCGCGATTTGGATCCGCTGATTGACGAGCTGCTGCGCCGGGTGCCAGGCAAGGTCTTGTACGGCACTGAT
TGGCCGCACACGCGCTTCGAGGGGCTGGACATTGGGCCCTGGACGAGGCGGCTGGAGCAGAGGGCTGGCGAGAGG
AATGCCACGGTGCGCAATGGCCTGTTTGGCGACAATGCCCAGCGCTTCTGGCGGTAA
Transcript >OphauG2|1788
ATGGCGGCAGTGCTGGTGCTGGCTTTGCTTGGCCTCGCATGGACTTGGATTCTCGACTCGGCCCCGTCGCTGCCT
CTGCCGTCGACTTCAAGCTCGTCTTGGCCGGCGGCGACGGGCTGGGACTCGCACATGCACCTCATCAACACGCAG
CGCTTCCCCGCCAGCGCAGATGCAGTCTACCAGCCCCGACGCCGCGACAACGCGACCGACGCCGCACTGTTTGAA
GCCAGCATTGGCTGCCAGGCCCTGACGGTGGTGCAGCCGTCGATATACGCCAACGACAACGCGCTGCTTCTCGAG
ACGCTCGGGGCGCTGGGGCTGGGCCGGGCTCGCGGCGTCGTGGTGTTTGATGCGCAAACGACGCCCAGGGCCACG
CTGCAGCAGTGGCACCGGGCGGGCGTGCGAGGGGCGCGGCTGAATCTGCGCAGCGCAAACAAGACGCTGGCGCCA
GACGTGCTGGCCCGGCGGCTCACGAGGTATGCGGATGCCCTCCGGCCGCTGGGCTGGGCGCTGCAGCTGTACGTG
GCCATGGACGCGCTGCCGGCGGTCGAGTCGGTGATTGCGCGTCTGGGCGTGCGCGTGGTGCTGGACCACTTGGGA
AGCCCCAAGATGCCGCCGTGGTGGCCAACAGACGCGGCGCGCGATCCATACTCGATTGGCGGCTTTGGGGCCATG
ATGCGGCTGCTGCAGGGTAACAGCACCTGGGTCAAGATTTCAGGGCCCTATCGCTGCTCCCAGGCGCCTGCGCCG
CTGTGGCGCGATTTGGATCCGCTGATTGACGAGCTGCTGCGCCGGGTGCCAGGCAAGGTCTTGTACGGCACTGAT
TGGCCGCACACGCGCTTCGAGGGGCTGGACATTGGGCCCTGGACGAGGCGGCTGGAGCAGAGGGCTGGCGAGAGG
AATGCCACGGTGCGCAATGGCCTGTTTGGCGACAATGCCCAGCGCTTCTGGCGGTAA
Gene >OphauG2|1788
ATGGCGGCAGTGCTGGTGCTGGCTTTGCTTGGCCTCGCATGGACTTGGATTCTCGACTCGGCCCCGTCGCTGCCT
CTGCCGTCGACTTCAAGCTCGTCTTGGCCGGCGGCGACGGGCTGGGACTCGCACATGCACCTCATCAACACGCAG
CGCTTCCCCGCCAGCGCAGATGCAGTCTACCAGCCCCGACGCCGCGACAACGCGACCGACGCCGCACTGTTTGAA
GCCAGCATTGGCTGCCAGGCCCTGACGGTGGTGCAGCCGTCGATATACGCCAACGACAACGCGCTGCTTCTCGAG
ACGCTCGGGGCGCTGGGGCTGGGCCGGGCTCGCGGCGTCGTGGTGTTTGATGCGCAAACGACGCCCAGGGCCACG
CTGCAGCAGTGGCACCGGGCGGGCGTGCGAGGGGCGCGGCTGAATCTGCGCAGCGCAAACAAGACGCTGGCGCCA
GACGTGCTGGCCCGGCGGCTCACGAGGTATGCGGATGCCCTCCGGCCGCTGGGCTGGGCGCTGCAGCTGTACGTG
GCCATGGACGCGCTGCCGGCGGTCGAGTCGGTGATTGCGCGTCTGGGCGTGCGCGTGGTGCTGGACCACTTGGGA
AGCCCCAAGATGCCGCCGTGGTGGCCAACAGACGCGGCGCGCGATCCATACTCGATTGGCGGCTTTGGGGCCATG
ATGCGGCTGCTGCAGGGTAACAGCACCTGGGTCAAGATTTCAGGGCCCTATCGCTGCTCCCAGGCGCCTGCGCCG
CTGTGGCGCGATTTGGATCCGCTGATTGACGAGCTGCTGCGCCGGGTGCCAGGCAAGGTCTTGTACGGCACTGAT
TGGCCGCACACGCGCTTCGAGGGGCTGGACATTGGGCCCTGGACGAGGCGGCTGGAGCAGAGGGCTGGCGAGAGG
AATGCCACGGTGCGCAATGGCCTGTTTGGCGACAATGCCCAGCGCTTCTGGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail