Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1765
Gene name
LocationContig_156:5229..7966
Strand-
Gene length (bp)2737
Transcript length (bp)2601
Coding sequence length (bp)2601
Protein length (aa) 867

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05470 eIF-3c_N Eukaryotic translation initiation factor 3 subunit 8 N-terminus 5.5E-176 67 634
PF01399 PCI PCI domain 2.1E-12 649 778

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBD4|EIF3C_NEUCR Eukaryotic translation initiation factor 3 subunit C OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nip-1 PE=3 SV=1 85 866 0.0E+00
sp|A4QSX4|EIF3C_MAGO7 Eukaryotic translation initiation factor 3 subunit C OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NIP1 PE=3 SV=1 81 866 0.0E+00
sp|P0CN47|EIF3C_CRYNB Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NIP1 PE=3 SV=1 65 808 0.0E+00
sp|P0CN46|EIF3C_CRYNJ Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NIP1 PE=3 SV=1 65 808 0.0E+00
sp|Q4P0P0|EIF3C_USTMA Eukaryotic translation initiation factor 3 subunit C OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NIP1 PE=3 SV=1 59 810 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBD4|EIF3C_NEUCR Eukaryotic translation initiation factor 3 subunit C OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nip-1 PE=3 SV=1 85 866 0.0E+00
sp|A4QSX4|EIF3C_MAGO7 Eukaryotic translation initiation factor 3 subunit C OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NIP1 PE=3 SV=1 81 866 0.0E+00
sp|P0CN47|EIF3C_CRYNB Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NIP1 PE=3 SV=1 65 808 0.0E+00
sp|P0CN46|EIF3C_CRYNJ Eukaryotic translation initiation factor 3 subunit C OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NIP1 PE=3 SV=1 65 808 0.0E+00
sp|Q4P0P0|EIF3C_USTMA Eukaryotic translation initiation factor 3 subunit C OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NIP1 PE=3 SV=1 59 810 0.0E+00
sp|Q6C855|EIF3C_YARLI Eukaryotic translation initiation factor 3 subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NIP1 PE=3 SV=1 1 805 0.0E+00
sp|O14164|EIF3C_SCHPO Eukaryotic translation initiation factor 3 subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nip1 PE=1 SV=2 66 835 0.0E+00
sp|Q5AX75|EIF3C_EMENI Eukaryotic translation initiation factor 3 subunit C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nip1 PE=3 SV=1 59 866 0.0E+00
sp|Q1DP77|EIF3C_COCIM Eukaryotic translation initiation factor 3 subunit C OS=Coccidioides immitis (strain RS) GN=NIP1 PE=3 SV=1 63 866 0.0E+00
sp|A1C987|EIF3C_ASPCL Eukaryotic translation initiation factor 3 subunit C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nip1 PE=3 SV=1 54 866 0.0E+00
sp|Q2U0Q9|EIF3C_ASPOR Eukaryotic translation initiation factor 3 subunit C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nip1 PE=3 SV=1 63 820 0.0E+00
sp|A1D9P1|EIF3C_NEOFI Eukaryotic translation initiation factor 3 subunit C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nip1 PE=3 SV=1 63 820 0.0E+00
sp|B0YEH1|EIF3C_ASPFC Eukaryotic translation initiation factor 3 subunit C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nip1 PE=3 SV=1 63 820 0.0E+00
sp|Q4W9S8|EIF3C_ASPFU Eukaryotic translation initiation factor 3 subunit C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nip1 PE=3 SV=1 63 820 0.0E+00
sp|Q0V1H5|EIF3C_PHANO Eukaryotic translation initiation factor 3 subunit C OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NIP1 PE=3 SV=1 1 866 0.0E+00
sp|A6S043|EIF3C_BOTFB Eukaryotic translation initiation factor 3 subunit C OS=Botryotinia fuckeliana (strain B05.10) GN=nip1 PE=3 SV=1 58 864 0.0E+00
sp|A7E471|EIF3C_SCLS1 Eukaryotic translation initiation factor 3 subunit C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nip1 PE=3 SV=1 1 864 0.0E+00
sp|Q2H731|EIF3C_CHAGB Eukaryotic translation initiation factor 3 subunit C OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NIP1 PE=3 SV=1 58 866 0.0E+00
sp|Q0CVT0|EIF3C_ASPTN Eukaryotic translation initiation factor 3 subunit C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nip1 PE=3 SV=1 1 820 0.0E+00
sp|Q6BJF7|EIF3C_DEBHA Eukaryotic translation initiation factor 3 subunit C OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NIP1 PE=3 SV=1 59 821 1.0E-168
sp|O49160|EIF3C_ARATH Eukaryotic translation initiation factor 3 subunit C OS=Arabidopsis thaliana GN=TIF3C1 PE=1 SV=2 45 813 5.0E-167
sp|Q9XHM1|EIF3C_MEDTR Eukaryotic translation initiation factor 3 subunit C OS=Medicago truncatula GN=TIF3C1 PE=2 SV=1 33 813 4.0E-164
sp|A3GGB4|EIF3C_PICST Eukaryotic translation initiation factor 3 subunit C OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NIP1 PE=3 SV=2 59 806 4.0E-159
sp|Q5AML1|EIF3C_CANAL Eukaryotic translation initiation factor 3 subunit C OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIP1 PE=3 SV=1 1 806 2.0E-157
sp|A5DPQ5|EIF3C_PICGU Eukaryotic translation initiation factor 3 subunit C OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NIP1 PE=3 SV=2 1 806 1.0E-156
sp|A5E3Q2|EIF3C_LODEL Eukaryotic translation initiation factor 3 subunit C OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NIP1 PE=3 SV=1 59 806 2.0E-145
sp|Q3SYW6|EIF3C_BOVIN Eukaryotic translation initiation factor 3 subunit C OS=Bos taurus GN=EIF3C PE=2 SV=1 250 850 5.0E-140
sp|Q6PFQ2|EIF3C_DANRE Eukaryotic translation initiation factor 3 subunit C OS=Danio rerio GN=eif3c PE=1 SV=1 254 850 3.0E-139
sp|Q5RAT8|EIF3C_PONAB Eukaryotic translation initiation factor 3 subunit C OS=Pongo abelii GN=EIF3C PE=2 SV=1 250 850 1.0E-138
sp|Q751S5|EIF3C_ASHGO Eukaryotic translation initiation factor 3 subunit C OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NIP1 PE=3 SV=1 1 793 1.0E-138
sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens GN=EIF3C PE=1 SV=1 250 850 2.0E-138
sp|B5ME19|EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens GN=EIF3CL PE=3 SV=1 250 850 2.0E-138
sp|B5DFC8|EIF3C_RAT Eukaryotic translation initiation factor 3 subunit C OS=Rattus norvegicus GN=Eif3c PE=1 SV=1 250 850 1.0E-137
sp|Q8R1B4|EIF3C_MOUSE Eukaryotic translation initiation factor 3 subunit C OS=Mus musculus GN=Eif3c PE=1 SV=1 250 850 2.0E-137
sp|Q4QR58|EIF3C_XENLA Eukaryotic translation initiation factor 3 subunit C OS=Xenopus laevis GN=eif3c PE=2 SV=1 250 818 4.0E-136
sp|Q7PMU8|EIF3C_ANOGA Eukaryotic translation initiation factor 3 subunit C OS=Anopheles gambiae GN=eIF3-S8 PE=3 SV=3 254 825 2.0E-135
sp|O02328|EIF3C_CAEEL Eukaryotic translation initiation factor 3 subunit C OS=Caenorhabditis elegans GN=eif-3.C PE=3 SV=2 229 854 2.0E-135
sp|A7TML4|EIF3C_VANPO Eukaryotic translation initiation factor 3 subunit C OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NIP1 PE=3 SV=1 63 793 6.0E-135
sp|Q6CLH3|EIF3C_KLULA Eukaryotic translation initiation factor 3 subunit C OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NIP1 PE=3 SV=1 59 792 2.0E-130
sp|P32497|EIF3C_YEAST Eukaryotic translation initiation factor 3 subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIP1 PE=1 SV=2 57 793 5.0E-130
sp|A6ZN26|EIF3C_YEAS7 Eukaryotic translation initiation factor 3 subunit C OS=Saccharomyces cerevisiae (strain YJM789) GN=NIP1 PE=3 SV=1 57 793 1.0E-129
sp|B4MRZ8|EIF3C_DROWI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila willistoni GN=eIF3-S8 PE=3 SV=1 222 831 3.0E-128
sp|B4KN00|EIF3C_DROMO Eukaryotic translation initiation factor 3 subunit C OS=Drosophila mojavensis GN=eIF3-S8 PE=3 SV=1 254 827 4.0E-128
sp|B3MIF1|EIF3C_DROAN Eukaryotic translation initiation factor 3 subunit C OS=Drosophila ananassae GN=eIF3-S8 PE=3 SV=1 254 858 7.0E-128
sp|B4P562|EIF3C_DROYA Eukaryotic translation initiation factor 3 subunit C OS=Drosophila yakuba GN=eIF3-S8 PE=3 SV=1 254 831 2.0E-127
sp|A8WWU0|EIF3C_CAEBR Eukaryotic translation initiation factor 3 subunit C OS=Caenorhabditis briggsae GN=eif-3.C PE=3 SV=1 231 854 2.0E-127
sp|Q0ZB76|EIF3C_BOMMO Eukaryotic translation initiation factor 3 subunit C OS=Bombyx mori GN=eIF3-S8 PE=2 SV=1 232 838 2.0E-127
sp|Q6FIJ6|EIF3C_CANGA Eukaryotic translation initiation factor 3 subunit C OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NIP1 PE=3 SV=1 61 793 4.0E-127
sp|B4HMY3|EIF3C_DROSE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila sechellia GN=eIF3-S8 PE=3 SV=1 254 831 1.0E-126
sp|A1ZAX1|EIF3C_DROME Eukaryotic translation initiation factor 3 subunit C OS=Drosophila melanogaster GN=eIF3-S8 PE=1 SV=1 254 831 1.0E-126
sp|B4LNA1|EIF3C_DROVI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila virilis GN=eIF3-S8 PE=3 SV=1 254 827 2.0E-126
sp|B3NML0|EIF3C_DROER Eukaryotic translation initiation factor 3 subunit C OS=Drosophila erecta GN=eIF3-S8 PE=3 SV=1 254 831 2.0E-126
sp|B4J789|EIF3C_DROGR Eukaryotic translation initiation factor 3 subunit C OS=Drosophila grimshawi GN=eIF3-S8 PE=3 SV=1 230 848 6.0E-125
sp|Q28Z41|EIF3C_DROPS Eukaryotic translation initiation factor 3 subunit C OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S8 PE=3 SV=1 254 831 8.0E-125
sp|B4GIB1|EIF3C_DROPE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila persimilis GN=eIF3-S8 PE=3 SV=1 254 831 8.0E-125
sp|Q54X97|EIF3C_DICDI Eukaryotic translation initiation factor 3 subunit C OS=Dictyostelium discoideum GN=eif3C PE=3 SV=1 200 815 2.0E-95
sp|Q28Z41|EIF3C_DROPS Eukaryotic translation initiation factor 3 subunit C OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S8 PE=3 SV=1 62 209 1.0E-12
sp|B4GIB1|EIF3C_DROPE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila persimilis GN=eIF3-S8 PE=3 SV=1 62 209 1.0E-12
sp|Q6P1V4|EIF3C_XENTR Eukaryotic translation initiation factor 3 subunit C OS=Xenopus tropicalis GN=eif3c PE=2 SV=1 77 211 6.0E-11
sp|A1ZAX1|EIF3C_DROME Eukaryotic translation initiation factor 3 subunit C OS=Drosophila melanogaster GN=eIF3-S8 PE=1 SV=1 67 208 1.0E-10
sp|B4HMY3|EIF3C_DROSE Eukaryotic translation initiation factor 3 subunit C OS=Drosophila sechellia GN=eIF3-S8 PE=3 SV=1 67 208 1.0E-10
sp|B4MRZ8|EIF3C_DROWI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila willistoni GN=eIF3-S8 PE=3 SV=1 62 198 1.0E-10
sp|B4P562|EIF3C_DROYA Eukaryotic translation initiation factor 3 subunit C OS=Drosophila yakuba GN=eIF3-S8 PE=3 SV=1 67 208 2.0E-10
sp|B3NML0|EIF3C_DROER Eukaryotic translation initiation factor 3 subunit C OS=Drosophila erecta GN=eIF3-S8 PE=3 SV=1 67 208 2.0E-10
sp|B4KN00|EIF3C_DROMO Eukaryotic translation initiation factor 3 subunit C OS=Drosophila mojavensis GN=eIF3-S8 PE=3 SV=1 67 211 2.0E-10
sp|Q6PFQ2|EIF3C_DANRE Eukaryotic translation initiation factor 3 subunit C OS=Danio rerio GN=eif3c PE=1 SV=1 77 211 2.0E-10
sp|B5ME19|EIFCL_HUMAN Eukaryotic translation initiation factor 3 subunit C-like protein OS=Homo sapiens GN=EIF3CL PE=3 SV=1 75 211 3.0E-10
sp|Q8R1B4|EIF3C_MOUSE Eukaryotic translation initiation factor 3 subunit C OS=Mus musculus GN=Eif3c PE=1 SV=1 75 211 3.0E-10
sp|Q5RAT8|EIF3C_PONAB Eukaryotic translation initiation factor 3 subunit C OS=Pongo abelii GN=EIF3C PE=2 SV=1 75 211 3.0E-10
sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens GN=EIF3C PE=1 SV=1 75 211 3.0E-10
sp|Q4QR58|EIF3C_XENLA Eukaryotic translation initiation factor 3 subunit C OS=Xenopus laevis GN=eif3c PE=2 SV=1 77 211 5.0E-10
sp|Q3SYW6|EIF3C_BOVIN Eukaryotic translation initiation factor 3 subunit C OS=Bos taurus GN=EIF3C PE=2 SV=1 75 209 7.0E-10
sp|B4J789|EIF3C_DROGR Eukaryotic translation initiation factor 3 subunit C OS=Drosophila grimshawi GN=eIF3-S8 PE=3 SV=1 64 214 1.0E-09
sp|B5DFC8|EIF3C_RAT Eukaryotic translation initiation factor 3 subunit C OS=Rattus norvegicus GN=Eif3c PE=1 SV=1 75 209 1.0E-09
sp|B3MIF1|EIF3C_DROAN Eukaryotic translation initiation factor 3 subunit C OS=Drosophila ananassae GN=eIF3-S8 PE=3 SV=1 67 196 2.0E-09
sp|B4LNA1|EIF3C_DROVI Eukaryotic translation initiation factor 3 subunit C OS=Drosophila virilis GN=eIF3-S8 PE=3 SV=1 77 212 2.0E-09
sp|Q7PMU8|EIF3C_ANOGA Eukaryotic translation initiation factor 3 subunit C OS=Anopheles gambiae GN=eIF3-S8 PE=3 SV=3 77 196 5.0E-09
sp|Q0ZB76|EIF3C_BOMMO Eukaryotic translation initiation factor 3 subunit C OS=Bombyx mori GN=eIF3-S8 PE=2 SV=1 77 200 5.0E-08
sp|Q17Q06|EIF3C_AEDAE Eukaryotic translation initiation factor 3 subunit C OS=Aedes aegypti GN=eIF3-S8 PE=3 SV=1 77 196 2.0E-07
sp|Q54X97|EIF3C_DICDI Eukaryotic translation initiation factor 3 subunit C OS=Dictyostelium discoideum GN=eif3C PE=3 SV=1 72 196 4.0E-07
sp|B0W0S3|EIF3C_CULQU Eukaryotic translation initiation factor 3 subunit C OS=Culex quinquefasciatus GN=eIF3-S8 PE=3 SV=1 77 196 4.0E-07
sp|A8WWU0|EIF3C_CAEBR Eukaryotic translation initiation factor 3 subunit C OS=Caenorhabditis briggsae GN=eif-3.C PE=3 SV=1 72 202 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031369 translation initiation factor binding Yes
GO:0006413 translational initiation Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0003743 translation initiation factor activity Yes
GO:0045182 translation regulator activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0005515 protein binding No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0008135 translation factor activity, RNA binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3459
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1765 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3707
Ophiocordyceps camponoti-floridani Ophcf2|01347
Ophiocordyceps camponoti-rufipedis Ophun1|2369
Ophiocordyceps kimflemingae Ophio5|7593
Ophiocordyceps subramaniannii Hirsu2|6594

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1765
MSRFFRGGDDSSSDSSTDEEELYSGEEDGQDVDQQDSDGDSDNGSQEDSEASSSSDEGGNRQGPNKFLKDAASES
EDSDEEVRAKIKSAKDKRLDELESSIKQIENGQKNGDWTLISTEYDKLNKQVTKLPDGRKTPKQYIRIVAELEDF
MNESLAKQKVTPTKKMNTTQYRALNAVKQKLKKTNKEYQTQIDEYRKDKDAYMESDDEEEEAPIVKPKKAPKFEI
DAMTEEADDEGFATVGKGGRTLQYTPESIFKHLRTIMESRGKKNTDRTEQIKVMEKLGEIANTPYQKLRVYLTLV
SARFDLGSGTSNAMPLDHWKAAEKELSSLLEILRTNHDYVVVENVEEWDDDEKPPTMQPGDKYIKVAGSIVSFME
RLDDELVRSLQNIDPHTSEYIERLQDEGALYNIIFRCLLYYERLQKDESLEIAQESINRIVVRRLEHVYFKPAQV
VKTFEENSWKAVGDDIDSAITPRQRAQDAGSLVNVLCNYLFSHDDGIRRARAMLCQVYFLALHGEYYKARDMMLM
SHLQETIPNFDVQTQILYNRTLVQVGLCAFRKGLVYDAQTTLQEICGSGRQKELLAQGVMMQRYNQVSPEQERLE
KQRQLPFHMHINLELLECVYLTCSMLLEIPLLAQTGSSPDVKKRVISKTYRRMLEYHERQIFTGPPENTRDHVMQ
ASKALAAGEWKKSTNFIHSIKIWDLMPNCEEIKTMLSKQIQEEGLRTYLFTYAPFYDTLALETLGSMFELDLTKV
AAVVSKMISHEELAASLDQVTSTLIFRKGVELSRLQSLALTLSDKASQLIETNERTLEQRTQGTSNAFERQGGRG
RGGARGGQRSGRGGARGGGNTQRQAGGTQFTGGALGAAVRG*
Coding >OphauG2|1765
ATGTCTCGCTTCTTCCGTGGGGGCGACGACAGTTCGTCCGACTCATCTACTGATGAGGAGGAGCTCTACTCTGGC
GAAGAAGATGGCCAGGACGTGGACCAGCAAGACTCGGACGGCGACTCGGATAACGGGTCTCAGGAAGATAGCGAA
GCCAGCTCAAGCAGCGATGAGGGCGGTAATCGCCAGGGGCCCAACAAGTTCTTAAAGGACGCTGCCTCGGAAAGC
GAGGATAGCGACGAGGAGGTTCGCGCCAAGATCAAAAGTGCCAAAGATAAGCGCCTGGATGAGCTCGAGTCGTCG
ATCAAGCAGATTGAAAACGGGCAAAAGAATGGCGACTGGACTCTCATTTCTACTGAGTACGACAAGCTCAACAAA
CAAGTGACAAAGCTACCGGATGGACGCAAGACGCCCAAGCAATACATTCGGATTGTTGCCGAGCTGGAAGACTTT
ATGAATGAGTCATTGGCAAAGCAAAAAGTGACCCCCACTAAAAAAATGAATACGACACAGTACCGAGCGCTCAAC
GCCGTCAAGCAAAAACTCAAAAAGACAAACAAGGAGTACCAGACACAGATTGACGAGTACCGAAAGGACAAGGAT
GCCTACATGGAGTCTGATGACGAGGAGGAGGAAGCGCCGATTGTCAAGCCCAAAAAGGCCCCCAAGTTTGAAATC
GATGCCATGACAGAAGAAGCCGACGATGAAGGCTTTGCTACTGTTGGCAAGGGCGGCCGCACGCTGCAATACACG
CCCGAAAGCATCTTCAAGCACCTCCGGACCATTATGGAGTCGCGTGGCAAGAAGAATACGGACCGGACTGAGCAG
ATCAAGGTGATGGAGAAGCTTGGCGAAATCGCAAACACGCCATACCAAAAGCTTCGCGTCTACCTCACCCTTGTT
TCGGCGCGTTTTGACTTGGGCTCTGGCACCTCGAATGCCATGCCCCTCGATCACTGGAAGGCTGCGGAAAAGGAG
CTTTCCTCTCTCCTTGAGATTCTCCGCACAAACCACGACTATGTGGTTGTCGAAAATGTTGAAGAGTGGGACGAT
GACGAGAAGCCACCGACGATGCAGCCTGGCGACAAGTACATCAAGGTTGCTGGCAGCATTGTTTCCTTCATGGAG
AGGCTCGACGACGAACTTGTCCGCTCTCTCCAGAACATCGACCCCCACACATCCGAGTATATTGAGCGTTTGCAG
GACGAAGGCGCGCTCTACAACATTATTTTTCGCTGTTTGCTCTACTATGAGCGCTTGCAAAAGGACGAATCTCTG
GAGATTGCGCAGGAGAGCATCAATCGCATTGTTGTACGAAGACTGGAACACGTCTACTTCAAGCCGGCTCAGGTT
GTCAAGACATTTGAGGAGAATTCGTGGAAGGCCGTGGGAGACGACATTGACTCGGCCATTACCCCGCGTCAACGT
GCCCAGGACGCGGGCAGCCTAGTCAATGTTCTCTGCAATTACCTCTTTAGCCACGACGACGGCATCCGACGGGCA
AGGGCCATGCTGTGCCAGGTCTACTTTTTGGCCCTCCATGGCGAGTACTACAAGGCCCGTGACATGATGCTCATG
TCGCATCTGCAAGAGACGATTCCCAACTTTGATGTGCAGACGCAGATTCTGTATAACCGGACACTTGTGCAGGTT
GGTCTGTGTGCCTTTCGCAAGGGCCTAGTGTACGATGCGCAGACGACGCTCCAGGAGATTTGCGGCAGTGGCAGA
CAAAAGGAGCTCTTGGCTCAGGGCGTCATGATGCAGCGATATAACCAAGTGTCACCGGAACAGGAACGGTTGGAG
AAGCAGCGCCAGCTGCCCTTTCACATGCACATCAACCTGGAGCTGCTCGAGTGTGTATACTTGACGTGCAGCATG
CTACTCGAGATTCCGTTGCTGGCCCAGACAGGATCGTCGCCCGATGTCAAGAAGCGCGTCATCAGCAAGACGTAT
AGGCGCATGCTCGAGTATCACGAGCGACAAATCTTTACGGGCCCGCCCGAGAATACGCGAGACCATGTGATGCAG
GCGTCCAAGGCACTGGCTGCGGGGGAGTGGAAAAAGTCGACCAACTTTATCCACAGCATCAAGATTTGGGACCTG
ATGCCAAATTGCGAGGAAATCAAGACGATGCTTTCAAAACAGATCCAGGAGGAAGGGCTGCGGACATATCTGTTT
ACGTATGCGCCATTTTACGACACTCTAGCGCTGGAGACCCTCGGGAGCATGTTTGAGCTCGACTTGACAAAGGTT
GCGGCGGTTGTGAGCAAAATGATTAGCCACGAGGAGCTGGCGGCGTCGCTGGACCAGGTGACGTCGACGCTCATT
TTCCGCAAGGGCGTGGAGCTCAGCCGGCTGCAGTCGCTGGCATTGACACTATCGGACAAGGCGAGCCAGTTGATT
GAGACAAATGAGCGGACACTGGAGCAGCGGACGCAGGGCACATCAAATGCATTTGAGCGCCAAGGCGGACGAGGC
CGGGGTGGAGCTAGAGGCGGCCAGCGGTCAGGACGAGGCGGCGCACGCGGCGGCGGAAACACGCAGAGACAGGCC
GGAGGAACGCAATTTACTGGCGGAGCACTGGGAGCGGCGGTGAGGGGATAA
Transcript >OphauG2|1765
ATGTCTCGCTTCTTCCGTGGGGGCGACGACAGTTCGTCCGACTCATCTACTGATGAGGAGGAGCTCTACTCTGGC
GAAGAAGATGGCCAGGACGTGGACCAGCAAGACTCGGACGGCGACTCGGATAACGGGTCTCAGGAAGATAGCGAA
GCCAGCTCAAGCAGCGATGAGGGCGGTAATCGCCAGGGGCCCAACAAGTTCTTAAAGGACGCTGCCTCGGAAAGC
GAGGATAGCGACGAGGAGGTTCGCGCCAAGATCAAAAGTGCCAAAGATAAGCGCCTGGATGAGCTCGAGTCGTCG
ATCAAGCAGATTGAAAACGGGCAAAAGAATGGCGACTGGACTCTCATTTCTACTGAGTACGACAAGCTCAACAAA
CAAGTGACAAAGCTACCGGATGGACGCAAGACGCCCAAGCAATACATTCGGATTGTTGCCGAGCTGGAAGACTTT
ATGAATGAGTCATTGGCAAAGCAAAAAGTGACCCCCACTAAAAAAATGAATACGACACAGTACCGAGCGCTCAAC
GCCGTCAAGCAAAAACTCAAAAAGACAAACAAGGAGTACCAGACACAGATTGACGAGTACCGAAAGGACAAGGAT
GCCTACATGGAGTCTGATGACGAGGAGGAGGAAGCGCCGATTGTCAAGCCCAAAAAGGCCCCCAAGTTTGAAATC
GATGCCATGACAGAAGAAGCCGACGATGAAGGCTTTGCTACTGTTGGCAAGGGCGGCCGCACGCTGCAATACACG
CCCGAAAGCATCTTCAAGCACCTCCGGACCATTATGGAGTCGCGTGGCAAGAAGAATACGGACCGGACTGAGCAG
ATCAAGGTGATGGAGAAGCTTGGCGAAATCGCAAACACGCCATACCAAAAGCTTCGCGTCTACCTCACCCTTGTT
TCGGCGCGTTTTGACTTGGGCTCTGGCACCTCGAATGCCATGCCCCTCGATCACTGGAAGGCTGCGGAAAAGGAG
CTTTCCTCTCTCCTTGAGATTCTCCGCACAAACCACGACTATGTGGTTGTCGAAAATGTTGAAGAGTGGGACGAT
GACGAGAAGCCACCGACGATGCAGCCTGGCGACAAGTACATCAAGGTTGCTGGCAGCATTGTTTCCTTCATGGAG
AGGCTCGACGACGAACTTGTCCGCTCTCTCCAGAACATCGACCCCCACACATCCGAGTATATTGAGCGTTTGCAG
GACGAAGGCGCGCTCTACAACATTATTTTTCGCTGTTTGCTCTACTATGAGCGCTTGCAAAAGGACGAATCTCTG
GAGATTGCGCAGGAGAGCATCAATCGCATTGTTGTACGAAGACTGGAACACGTCTACTTCAAGCCGGCTCAGGTT
GTCAAGACATTTGAGGAGAATTCGTGGAAGGCCGTGGGAGACGACATTGACTCGGCCATTACCCCGCGTCAACGT
GCCCAGGACGCGGGCAGCCTAGTCAATGTTCTCTGCAATTACCTCTTTAGCCACGACGACGGCATCCGACGGGCA
AGGGCCATGCTGTGCCAGGTCTACTTTTTGGCCCTCCATGGCGAGTACTACAAGGCCCGTGACATGATGCTCATG
TCGCATCTGCAAGAGACGATTCCCAACTTTGATGTGCAGACGCAGATTCTGTATAACCGGACACTTGTGCAGGTT
GGTCTGTGTGCCTTTCGCAAGGGCCTAGTGTACGATGCGCAGACGACGCTCCAGGAGATTTGCGGCAGTGGCAGA
CAAAAGGAGCTCTTGGCTCAGGGCGTCATGATGCAGCGATATAACCAAGTGTCACCGGAACAGGAACGGTTGGAG
AAGCAGCGCCAGCTGCCCTTTCACATGCACATCAACCTGGAGCTGCTCGAGTGTGTATACTTGACGTGCAGCATG
CTACTCGAGATTCCGTTGCTGGCCCAGACAGGATCGTCGCCCGATGTCAAGAAGCGCGTCATCAGCAAGACGTAT
AGGCGCATGCTCGAGTATCACGAGCGACAAATCTTTACGGGCCCGCCCGAGAATACGCGAGACCATGTGATGCAG
GCGTCCAAGGCACTGGCTGCGGGGGAGTGGAAAAAGTCGACCAACTTTATCCACAGCATCAAGATTTGGGACCTG
ATGCCAAATTGCGAGGAAATCAAGACGATGCTTTCAAAACAGATCCAGGAGGAAGGGCTGCGGACATATCTGTTT
ACGTATGCGCCATTTTACGACACTCTAGCGCTGGAGACCCTCGGGAGCATGTTTGAGCTCGACTTGACAAAGGTT
GCGGCGGTTGTGAGCAAAATGATTAGCCACGAGGAGCTGGCGGCGTCGCTGGACCAGGTGACGTCGACGCTCATT
TTCCGCAAGGGCGTGGAGCTCAGCCGGCTGCAGTCGCTGGCATTGACACTATCGGACAAGGCGAGCCAGTTGATT
GAGACAAATGAGCGGACACTGGAGCAGCGGACGCAGGGCACATCAAATGCATTTGAGCGCCAAGGCGGACGAGGC
CGGGGTGGAGCTAGAGGCGGCCAGCGGTCAGGACGAGGCGGCGCACGCGGCGGCGGAAACACGCAGAGACAGGCC
GGAGGAACGCAATTTACTGGCGGAGCACTGGGAGCGGCGGTGAGGGGATAA
Gene >OphauG2|1765
ATGTCTCGCTTCTTCCGTGGGGGCGACGACAGTTCGTCCGACTCATCTACTGATGAGGAGGAGCTCTACTCTGGC
GAAGAAGATGGCCAGGACGTGGACCAGCAAGACTCGGACGGCGACTCGGATAACGGGTCTCAGGAAGATAGCGAA
GCCAGCTCAAGCAGCGATGAGGGCGGTAATCGCCAGGGGCCCAACAAGTTCTTAAAGGACGCTGCCTCGGAAAGC
GAGGATAGCGACGAGGAGGTTCGCGCCAAGATCAAAAGTGCCAAAGATAAGCGCCTGGATGAGCTCGAGTCGTCG
ATCAAGCAGATTGAAAACGGGCAAAAGAATGGCGACTGGACTCTCATTTCTACTGGTACGTGCCAAATGGCGTTT
GAACTAGCGCATCACGAACAATACTGACTTTGAGCGACAGAGTACGACAAGCTCAACAAACAAGTGACAAAGCTA
CCGGATGGACGCAAGACGCCCAAGCAATACATTCGGATTGTTGCCGAGCTGGAAGACTTTATGAATGAGTCATTG
GCAAAGCAAAAAGTGACCCCCACTAAAAAAATGAATACGACACAGTACCGAGCGCTCAACGCCGTCAAGCAAAAA
CTCAAAAAGACAAACAAGGAGTACCAGACACAGATTGACGAGTACCGAAAGGACAAGGATGCCTACATGGAGTCT
GATGACGAGGAGGAGGAAGCGCCGATTGTCAAGCCCAAAAAGGCCCCCAAGTTTGAAATCGATGCCATGACAGAA
GAAGCCGACGATGAAGGCTTTGCTACTGTTGGCAAGGGCGGCCGCACGCTGCAATACACGCCCGAAAGCATCTTC
AAGCACCTCCGGACCATTATGGAGTCGCGTGGCAAGAAGAATACGGACCGGACTGAGCAGATCAAGGTGATGGAG
AAGCTTGGCGAAATCGCAAACACGCCATACCAAAAGCTTCGCGTCTACCTCACCCTTGTTTCGGCGCGTTTTGAC
TTGGGCTCTGGCACCTCGAATGCCATGCCCCTCGATCACTGGAAGGCTGCGGAAAAGGAGCTTTCCTCTCTCCTT
GAGATTCTCCGCACAAACCACGACTATGTGGTTGTCGAAAATGTTGAAGAGTGGGACGATGACGAGAAGCCACCG
ACGATGCAGCCTGGCGACAAGTACATCAAGGTTGCTGGCAGCATTGTTTCCTTCATGGAGAGGCTCGACGACGAA
CTTGTCCGCTCTCTCCAGAACATCGACCCCCACACATCCGAGTATATTGAGCGTTTGCAGGACGAAGGCGCGCTC
TACAACATTATTTTTCGCTGTTTGCTCTACTATGAGCGCTTGCAAAAGGACGAATCTCTGGAGATTGCGCAGGAG
AGCATCAATCGCATTGTTGTACGAAGACTGGAACACGTCTACTTCAAGGTATGGCAAACATTGCTGATTTGTTGG
CGTAATCCATACCCCCCACCCTGTATCTTTGTCTAACACTGTACATTAGCCGGCTCAGGTTGTCAAGACATTTGA
GGAGAATTCGTGGAAGGCCGTGGGAGACGACATTGACTCGGCCATTACCCCGCGTCAACGTGCCCAGGACGCGGG
CAGCCTAGTCAATGTTCTCTGCAATTACCTCTTTAGCCACGACGACGGCATCCGACGGGCAAGGGCCATGCTGTG
CCAGGTCTACTTTTTGGCCCTCCATGGCGAGTACTACAAGGCCCGTGACATGATGCTCATGTCGCATCTGCAAGA
GACGATTCCCAACTTTGATGTGCAGACGCAGATTCTGTATAACCGGACACTTGTGCAGGTTGGTCTGTGTGCCTT
TCGCAAGGGCCTAGTGTACGATGCGCAGACGACGCTCCAGGAGATTTGCGGCAGTGGCAGACAAAAGGAGCTCTT
GGCTCAGGGCGTCATGATGCAGCGATATAACCAAGTGTCACCGGAACAGGAACGGTTGGAGAAGCAGCGCCAGCT
GCCCTTTCACATGCACATCAACCTGGAGCTGCTCGAGTGTGTATACTTGACGTGCAGCATGCTACTCGAGATTCC
GTTGCTGGCCCAGACAGGATCGTCGCCCGATGTCAAGAAGCGCGTCATCAGCAAGACGTATAGGCGCATGCTCGA
GTATCACGAGCGACAAATCTTTACGGGCCCGCCCGAGAATACGCGAGACCATGTGATGCAGGCGTCCAAGGCACT
GGCTGCGGGGGAGTGGAAAAAGTCGACCAACTTTATCCACAGCATCAAGATTTGGGACCTGATGCCAAATTGCGA
GGAAATCAAGACGATGCTTTCAAAACAGATCCAGGAGGAAGGGCTGCGGACATATCTGTTTACGTATGCGCCATT
TTACGACACTCTAGCGCTGGAGACCCTCGGGAGCATGTTTGAGCTCGACTTGACAAAGGTTGCGGCGGTTGTGAG
CAAAATGATTAGCCACGAGGAGCTGGCGGCGTCGCTGGACCAGGTGACGTCGACGCTCATTTTCCGCAAGGGCGT
GGAGCTCAGCCGGCTGCAGTCGCTGGCATTGACACTATCGGACAAGGCGAGCCAGTTGATTGAGACAAATGAGCG
GACACTGGAGCAGCGGACGCAGGGCACATCAAATGCATTTGAGCGCCAAGGCGGACGAGGCCGGGGTGGAGCTAG
AGGCGGCCAGCGGTCAGGACGAGGCGGCGCACGCGGCGGCGGAAACACGCAGAGACAGGCCGGAGGAACGCAATT
TACTGGCGGAGCACTGGGAGCGGCGGTGAGGGGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail