Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1756
Gene name
LocationContig_1556:210..3016
Strand-
Gene length (bp)2806
Transcript length (bp)2586
Coding sequence length (bp)2586
Protein length (aa) 862

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.1E+01 206 233
PF08238 Sel1 Sel1 repeat 9.0E-01 266 292
PF08238 Sel1 Sel1 repeat 2.8E+02 352 385
PF08238 Sel1 Sel1 repeat 8.8E-01 388 420
PF08238 Sel1 Sel1 repeat 8.7E-06 427 460

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 107 472 2.0E-42
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 192 479 8.0E-31
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 183 471 3.0E-26
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 131 470 8.0E-24
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 196 420 1.0E-12

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1756 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4891
Ophiocordyceps camponoti-floridani Ophcf2|01769
Ophiocordyceps camponoti-rufipedis Ophun1|1006
Ophiocordyceps kimflemingae Ophio5|4969
Ophiocordyceps subramaniannii Hirsu2|9772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1756
MANLGATFVPGGADDYFLPQVVSPAPQRITPQVPQNMQDDLQRLELNDSHDAHRMAHYVSSQQATTTDETDIRAY
RDIDNSSRSGVLDGMDWNAPSSSPSFSPSFSPFPKITGDNVPPSDDAKEEILWNARKHVLNSQKVTMQISWARDV
LIWAEIAMDAAAREPASKARSATPRIEHELRIDALNIITYLAQQDHPDALYIQSKWLEFGKFGHRVDKREAFNGY
RRAAELGNARSEYRMGMLFEQSNDMPRAKEHYSRGMALDDSAALYRMGMMSLLGQHGEARDYPRGLERIQAAAEG
ADEDAPQGSYVYGMLLGRELPDITIPDRLLPMKLDSAKMYVEKAAYLGFAKAQLKMGQAYELCQLSCEFYPSYSL
HYYGLAAKQGLPEAALGVSRWFLFGYEGVFKKNEELAFRYAHEAAVAKLATGEFAMGYYHEIGIHVPKQIDEARR
WYRLAADHGNKDALGRLESLDQHRSLSKADHETTTLTRIKSQHGSQKGKRPERLKQLSQQMPTLSEGSMPSTPVD
LGPRPGVKSPATVASPRISPLPSPGLRPTIVSEPTAFPDPSRASVVASDRQNSAFSIRSGNGRGRATGPLPDNQA
YHATSSQPLAPYPEDDVHGEWQSSSGLLGSSAFGVQAERPLSALGNKQQTAGPRPMPSSNSTGSLQLASQAPPRD
RHASAGYESHNVGSYGQASLASGGRSYMGGDEAQTRPVASLPYPTNNRLQKQQSPYSSMGGLDATREYGPSRPWS
RPGSEIGGQPDGHGPGAAGIRSERLSSLPAPDLARPPRTASGMAAPSMPMSPRLGPGGRTGSAPPGQTGHGVPSP
AAQSSASVAAKPSKGPATFEDMGIPQGKKESDCVLM*
Coding >OphauG2|1756
ATGGCCAACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGACGATTACTTTTTGCCCCAAGTCGTTTCTCCTGCG
CCGCAAAGAATAACACCCCAGGTGCCTCAAAACATGCAGGACGATTTGCAACGCCTTGAACTCAATGACAGCCAC
GACGCTCATCGCATGGCGCATTACGTCTCGTCTCAGCAGGCGACTACGACGGACGAGACGGACATCAGAGCCTAT
CGCGACATCGACAACAGCAGCCGCTCTGGCGTCCTCGACGGCATGGACTGGAACGCGCCCTCTTCCTCACCCTCT
TTCTCACCCTCCTTCTCACCCTTTCCCAAGATTACAGGCGATAACGTGCCGCCAAGCGATGACGCAAAGGAGGAA
ATCTTGTGGAATGCGCGCAAGCATGTCCTCAACTCGCAAAAGGTCACCATGCAGATAAGCTGGGCTCGCGACGTT
CTCATCTGGGCTGAGATTGCCATGGACGCTGCTGCCCGCGAGCCAGCTAGCAAGGCGCGGTCGGCAACGCCGCGT
ATTGAGCACGAGCTGCGTATTGATGCCCTCAACATCATCACTTATTTGGCCCAGCAGGATCATCCCGATGCCCTC
TACATACAATCCAAGTGGCTCGAGTTTGGAAAGTTTGGTCATCGCGTCGATAAGCGCGAGGCCTTCAACGGGTAC
CGACGCGCAGCCGAGCTGGGAAACGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATG
CCCAGAGCCAAGGAACACTACTCCCGGGGCATGGCTCTCGATGACTCGGCTGCCCTTTACCGTATGGGAATGATG
AGTCTCCTTGGCCAGCATGGTGAGGCGAGAGACTACCCCAGAGGACTGGAGCGCATTCAGGCTGCCGCCGAAGGC
GCAGATGAGGACGCCCCACAGGGCTCCTACGTCTACGGCATGCTTCTCGGCCGAGAACTCCCAGACATTACGATT
CCAGATAGACTCTTACCCATGAAGCTTGACTCAGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTCGCC
AAGGCTCAGCTCAAAATGGGCCAGGCATATGAGCTATGCCAGCTAAGTTGCGAATTCTATCCCTCTTACTCACTG
CATTACTATGGGCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGTCGTTGGTTCCTTTTTGGA
TATGAAGGTGTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCGTGGCCAAACTAGCA
ACAGGCGAATTTGCCATGGGATACTACCACGAAATTGGAATCCATGTGCCCAAGCAGATTGATGAGGCGCGCCGG
TGGTACAGGCTCGCCGCTGATCACGGAAACAAGGACGCTCTCGGACGTCTTGAATCGCTTGACCAGCACAGAAGC
CTGTCCAAGGCGGACCACGAGACGACCACCTTGACTCGCATCAAGTCGCAGCATGGCTCCCAGAAGGGCAAGAGA
CCGGAGCGACTCAAACAGCTATCGCAGCAGATGCCGACACTGAGCGAGGGTAGCATGCCGTCGACACCCGTCGAT
TTGGGCCCGAGGCCTGGAGTCAAATCACCCGCCACCGTGGCATCTCCACGTATTTCTCCTCTTCCGTCCCCAGGG
TTGAGGCCGACCATTGTATCTGAGCCGACTGCATTTCCCGACCCTTCCAGAGCATCGGTGGTAGCGTCAGATCGA
CAAAACTCGGCTTTTTCCATAAGAAGCGGGAATGGGCGAGGGCGTGCAACTGGCCCTTTGCCGGACAATCAAGCC
TATCATGCAACGTCATCTCAACCTTTGGCTCCGTATCCCGAAGATGACGTACATGGTGAATGGCAGAGCTCGAGT
GGACTACTTGGCTCCTCGGCGTTCGGTGTCCAGGCAGAGAGGCCTTTGAGCGCGTTAGGCAACAAACAACAAACG
GCGGGGCCGCGTCCAATGCCAAGTTCAAACAGCACCGGAAGTTTGCAGCTAGCATCACAGGCCCCTCCTCGCGAT
AGGCATGCGTCTGCTGGTTATGAGAGCCATAACGTCGGAAGCTATGGACAAGCCAGCCTTGCCTCAGGCGGCCGC
TCATACATGGGAGGAGATGAGGCGCAAACGCGGCCGGTAGCGTCTCTCCCGTATCCCACGAACAACAGACTGCAG
AAACAGCAATCTCCATATTCGTCGATGGGTGGATTAGACGCGACGCGCGAGTACGGGCCATCTCGGCCTTGGTCT
CGCCCAGGGTCTGAGATTGGTGGCCAGCCCGATGGCCACGGCCCTGGGGCGGCGGGCATCAGATCTGAACGACTC
AGTTCATTACCGGCCCCCGATCTTGCCAGACCGCCAAGGACGGCGTCGGGTATGGCAGCCCCATCGATGCCAATG
TCGCCCCGATTGGGCCCTGGAGGCAGAACGGGAAGTGCACCACCCGGACAAACTGGGCATGGGGTGCCAAGCCCG
GCAGCACAGAGCTCTGCAAGTGTGGCGGCAAAGCCGAGTAAAGGTCCAGCGACTTTTGAAGACATGGGGATTCCC
CAAGGGAAAAAGGAGAGCGACTGTGTTCTCATGTGA
Transcript >OphauG2|1756
ATGGCCAACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGACGATTACTTTTTGCCCCAAGTCGTTTCTCCTGCG
CCGCAAAGAATAACACCCCAGGTGCCTCAAAACATGCAGGACGATTTGCAACGCCTTGAACTCAATGACAGCCAC
GACGCTCATCGCATGGCGCATTACGTCTCGTCTCAGCAGGCGACTACGACGGACGAGACGGACATCAGAGCCTAT
CGCGACATCGACAACAGCAGCCGCTCTGGCGTCCTCGACGGCATGGACTGGAACGCGCCCTCTTCCTCACCCTCT
TTCTCACCCTCCTTCTCACCCTTTCCCAAGATTACAGGCGATAACGTGCCGCCAAGCGATGACGCAAAGGAGGAA
ATCTTGTGGAATGCGCGCAAGCATGTCCTCAACTCGCAAAAGGTCACCATGCAGATAAGCTGGGCTCGCGACGTT
CTCATCTGGGCTGAGATTGCCATGGACGCTGCTGCCCGCGAGCCAGCTAGCAAGGCGCGGTCGGCAACGCCGCGT
ATTGAGCACGAGCTGCGTATTGATGCCCTCAACATCATCACTTATTTGGCCCAGCAGGATCATCCCGATGCCCTC
TACATACAATCCAAGTGGCTCGAGTTTGGAAAGTTTGGTCATCGCGTCGATAAGCGCGAGGCCTTCAACGGGTAC
CGACGCGCAGCCGAGCTGGGAAACGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAATCCAACGATATG
CCCAGAGCCAAGGAACACTACTCCCGGGGCATGGCTCTCGATGACTCGGCTGCCCTTTACCGTATGGGAATGATG
AGTCTCCTTGGCCAGCATGGTGAGGCGAGAGACTACCCCAGAGGACTGGAGCGCATTCAGGCTGCCGCCGAAGGC
GCAGATGAGGACGCCCCACAGGGCTCCTACGTCTACGGCATGCTTCTCGGCCGAGAACTCCCAGACATTACGATT
CCAGATAGACTCTTACCCATGAAGCTTGACTCAGCCAAGATGTACGTGGAAAAAGCGGCCTACTTGGGCTTCGCC
AAGGCTCAGCTCAAAATGGGCCAGGCATATGAGCTATGCCAGCTAAGTTGCGAATTCTATCCCTCTTACTCACTG
CATTACTATGGGCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGTCGTTGGTTCCTTTTTGGA
TATGAAGGTGTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCGTGGCCAAACTAGCA
ACAGGCGAATTTGCCATGGGATACTACCACGAAATTGGAATCCATGTGCCCAAGCAGATTGATGAGGCGCGCCGG
TGGTACAGGCTCGCCGCTGATCACGGAAACAAGGACGCTCTCGGACGTCTTGAATCGCTTGACCAGCACAGAAGC
CTGTCCAAGGCGGACCACGAGACGACCACCTTGACTCGCATCAAGTCGCAGCATGGCTCCCAGAAGGGCAAGAGA
CCGGAGCGACTCAAACAGCTATCGCAGCAGATGCCGACACTGAGCGAGGGTAGCATGCCGTCGACACCCGTCGAT
TTGGGCCCGAGGCCTGGAGTCAAATCACCCGCCACCGTGGCATCTCCACGTATTTCTCCTCTTCCGTCCCCAGGG
TTGAGGCCGACCATTGTATCTGAGCCGACTGCATTTCCCGACCCTTCCAGAGCATCGGTGGTAGCGTCAGATCGA
CAAAACTCGGCTTTTTCCATAAGAAGCGGGAATGGGCGAGGGCGTGCAACTGGCCCTTTGCCGGACAATCAAGCC
TATCATGCAACGTCATCTCAACCTTTGGCTCCGTATCCCGAAGATGACGTACATGGTGAATGGCAGAGCTCGAGT
GGACTACTTGGCTCCTCGGCGTTCGGTGTCCAGGCAGAGAGGCCTTTGAGCGCGTTAGGCAACAAACAACAAACG
GCGGGGCCGCGTCCAATGCCAAGTTCAAACAGCACCGGAAGTTTGCAGCTAGCATCACAGGCCCCTCCTCGCGAT
AGGCATGCGTCTGCTGGTTATGAGAGCCATAACGTCGGAAGCTATGGACAAGCCAGCCTTGCCTCAGGCGGCCGC
TCATACATGGGAGGAGATGAGGCGCAAACGCGGCCGGTAGCGTCTCTCCCGTATCCCACGAACAACAGACTGCAG
AAACAGCAATCTCCATATTCGTCGATGGGTGGATTAGACGCGACGCGCGAGTACGGGCCATCTCGGCCTTGGTCT
CGCCCAGGGTCTGAGATTGGTGGCCAGCCCGATGGCCACGGCCCTGGGGCGGCGGGCATCAGATCTGAACGACTC
AGTTCATTACCGGCCCCCGATCTTGCCAGACCGCCAAGGACGGCGTCGGGTATGGCAGCCCCATCGATGCCAATG
TCGCCCCGATTGGGCCCTGGAGGCAGAACGGGAAGTGCACCACCCGGACAAACTGGGCATGGGGTGCCAAGCCCG
GCAGCACAGAGCTCTGCAAGTGTGGCGGCAAAGCCGAGTAAAGGTCCAGCGACTTTTGAAGACATGGGGATTCCC
CAAGGGAAAAAGGAGAGCGACTGTGTTCTCATGTGA
Gene >OphauG2|1756
ATGGCCAACTTGGGTGCGACGTTTGTGCCTGGTGGTGCCGACGATTACTTTTTGCCCCAAGTCGTTTCTCCTGCG
CCGCAAAGGTGAGAGATTAAGACAGAAGGGCACTGCCTCAGACTGCCCCAGCCTAGCGTTGTTGCAATTTGATAG
TGGTGTTCATTTTTATTTTCTTATTCTTTTCATTTCTTTTTTTATTTGGGGGGCGGAGGGGGAGGGTGCGGCGAT
TTGCTGACAGCCTGACCTAGAATAACACCCCAGGTGCCTCAAAACATGCAGGACGATTTGCAACGCCTTGAACTC
AATGACAGCCACGACGCTCATCGCATGGCGCATTACGTCTCGTCTCAGCAGGCGACTACGACGGACGAGACGGAC
ATCAGAGCCTATCGCGACATCGACAACAGCAGCCGCTCTGGCGTCCTCGACGGCATGGACTGGAACGCGCCCTCT
TCCTCACCCTCTTTCTCACCCTCCTTCTCACCCTTTCCCAAGATTACAGGCGATAACGTGCCGCCAAGCGATGAC
GCAAAGGAGGAAATCTTGTGGAATGCGCGCAAGCATGTCCTCAACTCGCAAAAGGTCACCATGCAGATAAGCTGG
GCTCGCGACGTTCTCATCTGGGCTGAGATTGCCATGGACGCTGCTGCCCGCGAGCCAGCTAGCAAGGCGCGGTCG
GCAACGCCGCGTATTGAGCACGAGCTGCGTATTGATGCCCTCAACATCATCACTTATTTGGCCCAGCAGGATCAT
CCCGATGCCCTCTACATACAATCCAAGTGGCTCGAGTTTGGAAAGTTTGGTCATCGCGTCGATAAGCGCGAGGCC
TTCAACGGGTACCGACGCGCAGCCGAGCTGGGAAACGCACGCTCCGAGTACCGCATGGGCATGCTCTTTGAGCAA
TCCAACGATATGCCCAGAGCCAAGGAACACTACTCCCGGGGCATGGCTCTCGATGACTCGGCTGCCCTTTACCGT
ATGGGAATGATGAGTCTCCTTGGCCAGCATGGTGAGGCGAGAGACTACCCCAGAGGACTGGAGCGCATTCAGGCT
GCCGCCGAAGGCGCAGATGAGGACGCCCCACAGGGCTCCTACGTCTACGGCATGCTTCTCGGCCGAGAACTCCCA
GACATTACGATTCCAGATAGACTCTTACCCATGAAGCTTGACTCAGCCAAGATGTACGTGGAAAAAGCGGCCTAC
TTGGGCTTCGCCAAGGCTCAGCTCAAAATGGGCCAGGCATATGAGCTATGCCAGCTAAGTTGCGAATTCTATCCC
TCTTACTCACTGCATTACTATGGGCTGGCAGCCAAGCAAGGCTTGCCCGAGGCGGCGCTTGGAGTCAGTCGTTGG
TTCCTTTTTGGATATGAAGGTGTCTTTAAGAAGAACGAGGAGCTTGCTTTCCGCTACGCACACGAGGCAGCCGTG
GCCAAACTAGCAACAGGCGAATTTGCCATGGGATACTACCACGAAATTGGAATCCATGTGCCCAAGCAGATTGAT
GAGGCGCGCCGGTGGTACAGGCTCGCCGCTGATCACGGAAACAAGGACGCTCTCGGACGTCTTGAATCGCTTGAC
CAGCACAGAAGCCTGTCCAAGGCGGACCACGAGACGACCACCTTGACTCGCATCAAGTCGCAGCATGGCTCCCAG
AAGGGCAAGAGACCGGAGCGACTCAAACAGCTATCGCAGCAGATGCCGACACTGAGCGAGGGTAGCATGCCGTCG
ACACCCGTCGATTTGGGCCCGAGGCCTGGAGTCAAATCACCCGCCACCGTGGCATCTCCACGTATTTCTCCTCTT
CCGTCCCCAGGGTTGAGGCCGACCATTGTATCTGAGCCGACTGCATTTCCCGACCCTTCCAGAGCATCGGTGGTA
GCGTCAGATCGACAAAACTCGGCTTTTTCCATAAGAAGCGGGAATGGGCGAGGGCGTGCAACTGGCCCTTTGCCG
GACAATCAAGCCTATCATGCAACGTCATCTCAACCTTTGGCTCCGTATCCCGAAGATGACGTACATGGTGAATGG
CAGAGCTCGAGTGGACTACTTGGCTCCTCGGCGTTCGGTGTCCAGGCAGAGAGGCCTTTGAGCGCGTTAGGCAAC
AAACAACAAACGGCGGGGCCGCGTCCAATGCCAAGTTCAAACAGCACCGGAAGTTTGCAGCTAGCATCACAGGCC
CCTCCTCGCGATAGGCATGCGTCTGCTGGTTATGAGAGCCATAACGTCGGAAGCTATGGACAAGCCAGCCTTGCC
TCAGGCGGCCGCTCATACATGGGAGGAGATGAGGCGCAAACGCGGCCGGTAGCGTCTCTCCCGTATCCCACGAAC
AACAGACTGCAGAAACAGCAATCTCCATATTCGTCGATGGGTGGATTAGACGCGACGCGCGAGTACGGGCCATCT
CGGCCTTGGTCTCGCCCAGGGTCTGAGATTGGTGGCCAGCCCGATGGCCACGGCCCTGGGGCGGCGGGCATCAGA
TCTGAACGACTCAGTTCATTACCGGCCCCCGATCTTGCCAGACCGCCAAGGACGGCGTCGGGTATGGCAGCCCCA
TCGATGCCAATGTCGCCCCGATTGGGCCCTGGAGGCAGAACGGGAAGTGCACCACCCGGACAAACTGGGCATGGG
GTGCCAAGCCCGGCAGCACAGAGCTCTGCAAGTGTGGCGGCAAAGCCGAGTAAAGGTCCAGCGACTTTTGAAGAC
ATGGGGATTCCCCAAGGGAAAAAGGAGAGCGACTGTGTAAGTAGCTTGTTGTGTGTGCATCTCCTCTCCTTGATG
TCACTGACCCTGGTTCAAGGTTCTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail