Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1745
Gene name
LocationContig_155:24317..25523
Strand-
Gene length (bp)1206
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08546 ApbA_C Ketopantoate reductase PanE/ApbA C terminal 3.4E-28 233 362
PF02558 ApbA Ketopantoate reductase PanE/ApbA 4.2E-25 19 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDU6|PANE_SCHPO Probable 2-dehydropantoate 2-reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.09c PE=3 SV=1 19 361 2.0E-22
sp|Q9HW09|PANE_PSEAE Probable 2-dehydropantoate 2-reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panE PE=3 SV=1 20 363 1.0E-20
sp|Q8ZC51|PANE_YERPE 2-dehydropantoate 2-reductase OS=Yersinia pestis GN=panE PE=3 SV=1 112 362 2.0E-19
sp|Q9KPQ9|PANE_VIBCH 2-dehydropantoate 2-reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=panE PE=3 SV=1 112 363 5.0E-19
sp|Q8XE72|PANE_ECO57 2-dehydropantoate 2-reductase OS=Escherichia coli O157:H7 GN=panE PE=3 SV=1 112 362 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDU6|PANE_SCHPO Probable 2-dehydropantoate 2-reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.09c PE=3 SV=1 19 361 2.0E-22
sp|Q9HW09|PANE_PSEAE Probable 2-dehydropantoate 2-reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=panE PE=3 SV=1 20 363 1.0E-20
sp|Q8ZC51|PANE_YERPE 2-dehydropantoate 2-reductase OS=Yersinia pestis GN=panE PE=3 SV=1 112 362 2.0E-19
sp|Q9KPQ9|PANE_VIBCH 2-dehydropantoate 2-reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=panE PE=3 SV=1 112 363 5.0E-19
sp|Q8XE72|PANE_ECO57 2-dehydropantoate 2-reductase OS=Escherichia coli O157:H7 GN=panE PE=3 SV=1 112 362 5.0E-18
sp|P0A9J5|PANE_SHIFL 2-dehydropantoate 2-reductase OS=Shigella flexneri GN=panE PE=3 SV=1 112 362 9.0E-18
sp|P0A9J4|PANE_ECOLI 2-dehydropantoate 2-reductase OS=Escherichia coli (strain K12) GN=panE PE=1 SV=1 112 362 9.0E-18
sp|P37402|PANE_SALTY 2-dehydropantoate 2-reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=panE PE=1 SV=2 112 362 2.0E-17
sp|Q8Z8W3|PANE_SALTI 2-dehydropantoate 2-reductase OS=Salmonella typhi GN=panE PE=3 SV=1 112 362 3.0E-16
sp|P38787|PANE_YEAST 2-dehydropantoate 2-reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN5 PE=1 SV=1 19 336 3.0E-14
sp|O28578|PANE_ARCFU Putative 2-dehydropantoate 2-reductase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1695 PE=3 SV=1 18 360 7.0E-14
sp|Q9HRF0|PANE_HALSA Putative 2-dehydropantoate 2-reductase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_0730C PE=3 SV=1 54 363 8.0E-14
sp|O34661|PANE_BACSU Probable 2-dehydropantoate 2-reductase OS=Bacillus subtilis (strain 168) GN=panE PE=1 SV=1 112 363 1.0E-12
sp|O50098|PANE_PYRHO Putative 2-dehydropantoate 2-reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1390 PE=3 SV=1 18 366 3.0E-12
sp|O67619|PANE_AQUAE Putative 2-dehydropantoate 2-reductase OS=Aquifex aeolicus (strain VF5) GN=aq_1727 PE=3 SV=1 112 368 6.0E-09
sp|Q8ZT70|PANE_PYRAE Putative 2-dehydropantoate 2-reductase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE3409 PE=3 SV=1 96 365 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1745
MPLSNALASSLRRQPGARVHVLGLGSIGTFAAHALAEIPAPLRPASVTLLLHRASLVEPLLAGGRAISLQTRHGS
LVRHAGYRFEMLDGANRWLRDPLDSAPGLADEAIQNLVVSVKATQTVAALRPLRHRLTWASNILFLQNGSGMLDD
VNRELFANELERPNYIVGVVSHGVTLRSPFDIVHTGSGATWLGPVPSPSLPSSPSSSRRSSYLVDALPLAPRLKA
TSLPYRDVFQAQLEKLALNAFCNPLCALANAKNRYLCSIPHTKRALLSEISAVARALPELRHVPGVVSRFSLARL
EQTVDAIVGQTLETTCSMVVDLRRGRRTEIDYINGYWTRRGREVGVPTPLNDALVEQIRARQRLAALDLSDLAVA
QATTGNHGFIPELPSAATSFAVANGS*
Coding >OphauG2|1745
ATGCCCTTATCCAACGCCCTCGCATCCTCCCTCCGCCGTCAGCCAGGCGCACGTGTCCATGTTCTCGGCCTGGGC
AGCATCGGCACGTTTGCTGCACATGCCCTGGCCGAGATTCCCGCGCCGCTGCGGCCCGCGTCCGTCACCCTGCTC
CTCCACCGAGCCTCTCTCGTCGAGCCCCTCCTGGCTGGCGGGCGCGCCATCTCCCTCCAGACGCGCCACGGCTCC
CTGGTCCGCCATGCAGGATATCGCTTCGAGATGCTCGACGGCGCCAACCGCTGGCTGCGCGATCCGCTAGACTCG
GCCCCCGGCCTGGCTGACGAGGCTATCCAAAACCTCGTCGTCTCCGTCAAGGCCACCCAGACCGTAGCAGCGCTG
CGGCCCTTGCGCCACCGGCTGACCTGGGCCTCCAATATCCTCTTTCTCCAGAATGGGTCGGGCATGCTGGACGAC
GTTAACCGCGAGCTGTTTGCCAATGAGCTGGAGCGGCCCAACTACATTGTCGGCGTCGTCTCCCATGGCGTCACC
TTGAGAAGCCCCTTTGATATTGTCCACACCGGCTCGGGCGCTACATGGCTCGGCCCCGTCCCGTCTCCATCGCTG
CCCTCTTCCCCCTCGTCCTCTCGCCGCTCTTCCTACCTCGTCGATGCCCTCCCCCTCGCTCCGCGGCTCAAGGCA
ACGTCTCTGCCCTATCGCGACGTGTTCCAGGCCCAGCTCGAAAAACTCGCGCTAAACGCCTTTTGTAACCCGCTC
TGTGCTCTTGCCAACGCCAAGAATCGCTACCTCTGCTCCATTCCACACACTAAGCGCGCCCTGCTCTCTGAGATT
TCTGCCGTCGCTCGAGCCCTCCCCGAGCTGCGTCACGTGCCTGGCGTCGTCTCGCGCTTCAGCCTTGCCCGGCTA
GAGCAGACGGTCGACGCCATAGTCGGCCAGACTCTCGAGACGACGTGTTCCATGGTCGTGGACCTGAGACGTGGC
CGCCGCACCGAAATCGACTACATCAATGGCTACTGGACTAGACGCGGTCGAGAGGTCGGAGTCCCGACTCCCCTC
AACGATGCCCTAGTTGAGCAGATTCGCGCTCGCCAGCGCCTCGCAGCCCTTGACCTTTCCGATTTGGCTGTGGCC
CAGGCGACGACGGGAAACCATGGTTTCATCCCCGAACTCCCGTCTGCGGCAACGTCCTTTGCCGTGGCCAACGGC
AGTTGA
Transcript >OphauG2|1745
ATGCCCTTATCCAACGCCCTCGCATCCTCCCTCCGCCGTCAGCCAGGCGCACGTGTCCATGTTCTCGGCCTGGGC
AGCATCGGCACGTTTGCTGCACATGCCCTGGCCGAGATTCCCGCGCCGCTGCGGCCCGCGTCCGTCACCCTGCTC
CTCCACCGAGCCTCTCTCGTCGAGCCCCTCCTGGCTGGCGGGCGCGCCATCTCCCTCCAGACGCGCCACGGCTCC
CTGGTCCGCCATGCAGGATATCGCTTCGAGATGCTCGACGGCGCCAACCGCTGGCTGCGCGATCCGCTAGACTCG
GCCCCCGGCCTGGCTGACGAGGCTATCCAAAACCTCGTCGTCTCCGTCAAGGCCACCCAGACCGTAGCAGCGCTG
CGGCCCTTGCGCCACCGGCTGACCTGGGCCTCCAATATCCTCTTTCTCCAGAATGGGTCGGGCATGCTGGACGAC
GTTAACCGCGAGCTGTTTGCCAATGAGCTGGAGCGGCCCAACTACATTGTCGGCGTCGTCTCCCATGGCGTCACC
TTGAGAAGCCCCTTTGATATTGTCCACACCGGCTCGGGCGCTACATGGCTCGGCCCCGTCCCGTCTCCATCGCTG
CCCTCTTCCCCCTCGTCCTCTCGCCGCTCTTCCTACCTCGTCGATGCCCTCCCCCTCGCTCCGCGGCTCAAGGCA
ACGTCTCTGCCCTATCGCGACGTGTTCCAGGCCCAGCTCGAAAAACTCGCGCTAAACGCCTTTTGTAACCCGCTC
TGTGCTCTTGCCAACGCCAAGAATCGCTACCTCTGCTCCATTCCACACACTAAGCGCGCCCTGCTCTCTGAGATT
TCTGCCGTCGCTCGAGCCCTCCCCGAGCTGCGTCACGTGCCTGGCGTCGTCTCGCGCTTCAGCCTTGCCCGGCTA
GAGCAGACGGTCGACGCCATAGTCGGCCAGACTCTCGAGACGACGTGTTCCATGGTCGTGGACCTGAGACGTGGC
CGCCGCACCGAAATCGACTACATCAATGGCTACTGGACTAGACGCGGTCGAGAGGTCGGAGTCCCGACTCCCCTC
AACGATGCCCTAGTTGAGCAGATTCGCGCTCGCCAGCGCCTCGCAGCCCTTGACCTTTCCGATTTGGCTGTGGCC
CAGGCGACGACGGGAAACCATGGTTTCATCCCCGAACTCCCGTCTGCGGCAACGTCCTTTGCCGTGGCCAACGGC
AGTTGA
Gene >OphauG2|1745
ATGCCCTTATCCAACGCCCTCGCATCCTCCCTCCGCCGTCAGCCAGGCGCACGTGTCCATGTTCTCGGCCTGGGC
AGCATCGGCACGTTTGCTGCACATGCCCTGGCCGAGATTCCCGCGCCGCTGCGGCCCGCGTCCGTCACCCTGCTC
CTCCACCGAGCCTCTCTCGTCGAGCCCCTCCTGGCTGGCGGGCGCGCCATCTCCCTCCAGACGCGCCACGGCTCC
CTGGTCCGCCATGCAGGATATCGCTTCGAGATGCTCGACGGCGCCAACCGCTGGCTGCGCGATCCGCTAGACTCG
GCCCCCGGCCTGGCTGACGAGGCTATCCAAAACCTCGTCGTCTCCGTCAAGGCCACCCAGACCGTAGCAGCGCTG
CGGCCCTTGCGCCACCGGCTGACCTGGGCCTCCAATATCCTCTTTCTCCAGAATGGGTCGGGCATGCTGGACGAC
GTTAACCGCGAGCTGTTTGCCAATGAGCTGGAGCGGCCCAACTACATTGTCGGCGTCGTCTCCCATGGCGTCACC
TTGAGAAGCCCCTTTGATATTGTCCACACCGGCTCGGGCGCTACATGGCTCGGCCCCGTCCCGTCTCCATCGCTG
CCCTCTTCCCCCTCGTCCTCTCGCCGCTCTTCCTACCTCGTCGATGCCCTCCCCCTCGCTCCGCGGCTCAAGGCA
ACGTCTCTGCCCTATCGCGACGTGTTCCAGGCCCAGCTCGAAAAACTCGCGCTAAACGCCTTTTGTAACCCGCTC
TGTGCTCTTGCCAACGCCAAGAATCGCTACCTCTGCTCCATTCCACACACTAAGCGCGCCCTGCTCTCTGAGATT
TCTGCCGTCGCTCGAGCCCTCCCCGAGCTGCGTCACGTGCCTGGCGTCGTCTCGCGCTTCAGCCTTGCCCGGCTA
GAGCAGACGGTCGACGCCATAGTCGGCCAGACTCTCGAGACGACGTGTTCCATGGTCGTGGACCTGAGACGTGGC
CGCCGCACCGAAATCGACTACATCAATGGCTACTGGACTAGACGCGGTCGAGAGGTCGGAGTCCCGACTCCCCTC
AACGATGCCCTAGTTGAGCAGATTCGCGCTCGCCAGCGCCTCGCAGCCCTTGACCTTTCCGATTTGGCTGTGGCC
CAGGCGACGACGGGAAACCATGGTTTCATCCCCGAACTCCCGTCTGCGGCAACGTCCTTTGCCGTGGCCAACGGC
AGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail