Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1734
Gene name
LocationContig_1548:1834..3163
Strand+
Gene length (bp)1329
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 1.5E-53 2 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39623|SPSC_BACSU Spore coat polysaccharide biosynthesis protein SpsC OS=Bacillus subtilis (strain 168) GN=spsC PE=3 SV=1 3 336 6.0E-35
sp|Q6T1W6|FDTB_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase OS=Aneurinibacillus thermoaerophilus GN=fdtB PE=1 SV=1 3 335 2.0E-31
sp|Q07608|MOSB_RHIML Protein MosB OS=Rhizobium meliloti GN=mosB PE=3 SV=1 3 293 7.0E-29
sp|Q7DBF3|GDPPS_ECO57 GDP-perosamine synthase OS=Escherichia coli O157:H7 GN=perA PE=1 SV=1 4 201 2.0E-27
sp|Q9A9H3|GDPPS_CAUCR GDP-perosamine synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=per PE=1 SV=1 3 272 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39623|SPSC_BACSU Spore coat polysaccharide biosynthesis protein SpsC OS=Bacillus subtilis (strain 168) GN=spsC PE=3 SV=1 3 336 6.0E-35
sp|Q6T1W6|FDTB_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase OS=Aneurinibacillus thermoaerophilus GN=fdtB PE=1 SV=1 3 335 2.0E-31
sp|Q07608|MOSB_RHIML Protein MosB OS=Rhizobium meliloti GN=mosB PE=3 SV=1 3 293 7.0E-29
sp|Q7DBF3|GDPPS_ECO57 GDP-perosamine synthase OS=Escherichia coli O157:H7 GN=perA PE=1 SV=1 4 201 2.0E-27
sp|Q9A9H3|GDPPS_CAUCR GDP-perosamine synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=per PE=1 SV=1 3 272 2.0E-27
sp|Q70KD4|GLADA_MICEC Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Micromonospora echinospora GN=gtmD PE=3 SV=1 3 275 4.0E-27
sp|Q06953|GDPPS_VIBCL GDP-perosamine synthase OS=Vibrio cholerae GN=rfbE PE=1 SV=1 4 352 3.0E-26
sp|Q8G8Y2|GLDSA_BACCI L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Bacillus circulans GN=btrR PE=1 SV=1 1 360 3.0E-26
sp|Q58466|Y1066_METJA Uncharacterized protein MJ1066 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1066 PE=3 SV=1 3 345 5.0E-26
sp|Q8EEB1|KDNA_SHEON 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase OS=Shewanella oneidensis (strain MR-1) GN=kdnA PE=1 SV=1 4 256 8.0E-26
sp|Q2MFP2|GLDSA_STRRY L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces rimosus subsp. paromomycinus GN=parS PE=3 SV=1 2 222 2.0E-24
sp|Q53U20|GLDSA_STRFR L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces fradiae GN=neoB PE=1 SV=1 2 267 4.0E-23
sp|A6TFA0|ARNB_KLEP7 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=arnB PE=3 SV=2 1 272 1.0E-22
sp|B5XTK7|ARNB_KLEP3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=arnB PE=3 SV=1 1 272 2.0E-22
sp|Q4R0W2|GLDSA_STRRI L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces ribosidificus GN=rbmB PE=3 SV=1 2 269 2.0E-22
sp|A8GDR5|ARNB_SERP5 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Serratia proteamaculans (strain 568) GN=arnB PE=3 SV=1 3 272 3.0E-22
sp|Q4KC84|ARNB_PSEF5 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=arnB PE=3 SV=2 3 276 3.0E-22
sp|P77952|GLSA_STRGR L-glutamine:scyllo-inosose aminotransferase OS=Streptomyces griseus GN=stsC PE=1 SV=1 11 229 8.0E-22
sp|Q4ZSZ4|ARNB_PSEU2 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=arnB PE=3 SV=1 3 272 8.0E-22
sp|B2VBJ1|ARNB_ERWT9 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=arnB PE=3 SV=1 1 275 2.0E-21
sp|Q2MF12|GLADA_STRSD Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tobS2 PE=3 SV=1 3 275 3.0E-21
sp|Q3KCC3|ARNB_PSEPF UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=arnB PE=3 SV=1 3 275 3.0E-21
sp|Q6L733|GLADA_STRKN Putative L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase OS=Streptomyces kanamyceticus GN=kanD PE=3 SV=1 3 275 4.0E-21
sp|Q2MF71|GLDSA_STRLV L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces lividus GN=livS PE=3 SV=1 2 158 7.0E-21
sp|Q6L739|GLDSA_STRKN L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptomyces kanamyceticus GN=kanB PE=3 SV=1 2 260 1.0E-20
sp|Q2MF17|GLDSA_STRSD L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tbmB PE=3 SV=1 2 158 1.0E-20
sp|A4WAM5|ARNB_ENT38 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Enterobacter sp. (strain 638) GN=arnB PE=3 SV=1 1 272 3.0E-20
sp|Q9ZGH4|DESV_STRVZ dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase OS=Streptomyces venezuelae GN=desV PE=1 SV=1 6 364 3.0E-20
sp|B1JJ28|ARNB_YERPY UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|Q7BF87|ARNB_YERPS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=arnB PE=2 SV=1 3 274 3.0E-20
sp|A4TIM2|ARNB_YERPP UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis (strain Pestoides F) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|Q1CIH5|ARNB_YERPN UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|A9R095|ARNB_YERPG UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|Q93PE0|ARNB_YERPE UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|B2K5L5|ARNB_YERPB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|Q1C740|ARNB_YERPA UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|A7FHH2|ARNB_YERP3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=arnB PE=3 SV=1 3 274 3.0E-20
sp|A0KGY8|ARNB_AERHH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=arnB PE=3 SV=1 3 279 3.0E-20
sp|O52552|RIFK_AMYMS 3-amino-5-hydroxybenzoate synthase OS=Amycolatopsis mediterranei (strain S699) GN=rifK PE=1 SV=2 10 278 4.0E-20
sp|Q795J3|EPSN_BACSU Putative pyridoxal phosphate-dependent aminotransferase EpsN OS=Bacillus subtilis (strain 168) GN=epsN PE=2 SV=1 3 151 7.0E-20
sp|B7VBN4|ARNB_PSEA8 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=arnB PE=3 SV=1 3 272 9.0E-20
sp|Q02R23|ARNB_PSEAB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=arnB PE=3 SV=1 3 272 1.0E-19
sp|Q2NRV5|ARNB_SODGM UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Sodalis glossinidius (strain morsitans) GN=arnB PE=3 SV=1 1 272 1.0E-19
sp|Q9HY65|ARNB_PSEAE UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=arnB PE=3 SV=1 3 272 1.0E-19
sp|A4SQW7|ARNB_AERS4 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Aeromonas salmonicida (strain A449) GN=arnB PE=3 SV=1 2 278 1.0E-19
sp|C5BDQ4|ARNB_EDWI9 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Edwardsiella ictaluri (strain 93-146) GN=arnB PE=3 SV=1 3 276 2.0E-19
sp|A9N5B4|ARNB_SALPB UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=arnB PE=3 SV=1 1 272 2.0E-19
sp|B5R270|ARNB_SALEP UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=arnB PE=3 SV=2 1 272 2.0E-19
sp|B5EZH6|ARNB_SALA4 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella agona (strain SL483) GN=arnB PE=3 SV=1 1 272 2.0E-19
sp|A1JPP9|ARNB_YERE8 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=arnB PE=3 SV=1 3 272 3.0E-19
sp|C6DAW7|ARNB_PECCP UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=arnB PE=3 SV=1 3 278 3.0E-19
sp|P15263|DEGT_GEOSE Pleiotropic regulatory protein OS=Geobacillus stearothermophilus GN=degT PE=3 SV=1 5 360 3.0E-19
sp|B5FNT7|ARNB_SALDC UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=arnB PE=3 SV=2 1 272 3.0E-19
sp|Q6D2E9|ARNB_PECAS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=arnB PE=3 SV=1 3 278 4.0E-19
sp|Q8Z542|ARNB_SALTI UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella typhi GN=arnB PE=3 SV=2 1 272 5.0E-19
sp|Q7N3Q5|ARNB_PHOLL UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=arnB PE=3 SV=1 1 272 5.0E-19
sp|Q8ZNF3|ARNB_SALTY UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=arnB PE=1 SV=2 1 272 6.0E-19
sp|C0Q071|ARNB_SALPC UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=arnB PE=3 SV=2 1 272 6.0E-19
sp|B4SYW9|ARNB_SALNS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella newport (strain SL254) GN=arnB PE=3 SV=2 1 272 6.0E-19
sp|B4TBG4|ARNB_SALHS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella heidelberg (strain SL476) GN=arnB PE=3 SV=2 1 272 6.0E-19
sp|B5BCP8|ARNB_SALPK UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=arnB PE=3 SV=2 1 272 6.0E-19
sp|Q5PNA4|ARNB_SALPA UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=arnB PE=3 SV=2 1 272 6.0E-19
sp|A6V1P2|ARNB_PSEA7 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Pseudomonas aeruginosa (strain PA7) GN=arnB PE=3 SV=1 3 272 6.0E-19
sp|B4TPI0|ARNB_SALSV UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=arnB PE=3 SV=2 1 272 7.0E-19
sp|B1IXT4|ARNB_ECOLC UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=arnB PE=3 SV=1 1 278 8.0E-19
sp|B7N5L8|ARNB_ECOLU UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=arnB PE=3 SV=2 1 278 1.0E-18
sp|B5RCC2|ARNB_SALG2 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=arnB PE=3 SV=2 1 272 2.0E-18
sp|B4ETL5|ARNB_PROMH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Proteus mirabilis (strain HI4320) GN=arnB PE=3 SV=1 3 272 2.0E-18
sp|P26398|RFBH_SALTY Lipopolysaccharide biosynthesis protein RfbH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbH PE=3 SV=1 3 275 2.0E-18
sp|Q57M57|ARNB_SALCH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=arnB PE=3 SV=1 1 272 2.0E-18
sp|Q3YZV3|ARNB_SHISS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella sonnei (strain Ss046) GN=arnB PE=3 SV=2 1 278 7.0E-18
sp|B7LM78|ARNB_ESCF3 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=arnB PE=3 SV=1 1 275 9.0E-18
sp|B5YX44|ARNB_ECO5E UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|Q7AC24|ARNB_ECO57 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O157:H7 GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|B7M5T5|ARNB_ECO8A UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|Q31YK4|ARNB_SHIBS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|B1LLK7|ARNB_ECOSM UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|B6I7J6|ARNB_ECOSE UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain SE11) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|B7LAR8|ARNB_ECO55 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|A7ZP71|ARNB_ECO24 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=arnB PE=3 SV=1 1 278 1.0E-17
sp|B7NNT2|ARNB_ECO7I UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=arnB PE=3 SV=2 1 278 1.0E-17
sp|Q83QT9|ARNB_SHIFL UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella flexneri GN=arnB PE=3 SV=5 1 278 1.0E-17
sp|Q0T2N0|ARNB_SHIF8 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=arnB PE=3 SV=1 1 278 1.0E-17
sp|Q6QVU4|GLDSA_MICEC L-glutamine:2-deoxy-scyllo-inosose aminotransferase OS=Micromonospora echinospora GN=gntA PE=3 SV=1 1 159 3.0E-17
sp|P77690|ARNB_ECOLI UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain K12) GN=arnB PE=1 SV=2 1 278 3.0E-17
sp|A8A2C0|ARNB_ECOHS UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=arnB PE=3 SV=1 1 278 3.0E-17
sp|B1X8W6|ARNB_ECODH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=arnB PE=3 SV=1 1 278 3.0E-17
sp|C4ZU95|ARNB_ECOBW UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=arnB PE=3 SV=1 1 278 3.0E-17
sp|A8FRR4|ARNB_SHESH UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Shewanella sediminis (strain HAW-EB3) GN=arnB PE=3 SV=1 3 272 4.0E-17
sp|P14290|ERBS_SACEN Erythromycin biosynthesis sensory transduction protein EryC1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryC1 PE=3 SV=2 6 345 4.0E-17
sp|Q1R9G2|ARNB_ECOUT UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=arnB PE=3 SV=2 1 278 5.0E-17
sp|Q8FFM3|ARNB_ECOL6 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=arnB PE=3 SV=2 1 278 5.0E-17
sp|Q0TFI9|ARNB_ECOL5 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=arnB PE=3 SV=2 1 278 5.0E-17
sp|A1ADA5|ARNB_ECOK1 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O1:K1 / APEC GN=arnB PE=3 SV=2 1 278 5.0E-17
sp|B7MG20|ARNB_ECO45 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=arnB PE=3 SV=2 1 278 5.0E-17
sp|B7UFR5|ARNB_ECO27 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=arnB PE=3 SV=2 1 272 8.0E-17
sp|B7MXT4|ARNB_ECO81 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=arnB PE=3 SV=2 1 279 8.0E-17
sp|Q9F837|MEDII_MICMH dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase OS=Micromonospora megalomicea subsp. nigra GN=megDII PE=1 SV=1 2 279 1.0E-16
sp|O07566|NTDA_BACSU 3-oxo-glucose-6-phosphate:glutamate aminotransferase OS=Bacillus subtilis (strain 168) GN=ntdA PE=1 SV=1 5 270 1.0E-16
sp|O25130|PSEC_HELPY UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pseC PE=1 SV=1 3 219 1.0E-16
sp|Q5QKR7|PSEC_CAMJJ UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pseC PE=3 SV=1 3 216 6.0E-16
sp|P25048|DNRJ_STRPE Daunorubicin biosynthesis sensory transduction protein DnrJ OS=Streptomyces peucetius GN=dnrJ PE=3 SV=1 2 253 7.0E-16
sp|Q6U1I3|VIOA_SHIDY dTDP-4-amino-4,6-dideoxy-D-glucose transaminase OS=Shigella dysenteriae GN=vioA PE=1 SV=1 3 154 2.0E-15
sp|P27833|WECE_ECOLI dTDP-4-amino-4,6-dideoxygalactose transaminase OS=Escherichia coli (strain K12) GN=wecE PE=1 SV=2 3 159 1.0E-14
sp|Q9HZ76|WBPE_PSEAE UDP-2-acetamido-2-deoxy-3-oxo-D-glucuronate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpE PE=1 SV=1 3 154 4.0E-14
sp|Q0P8W3|PSEC_CAMJE UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pseC PE=1 SV=1 3 247 8.0E-14
sp|Q0P9D3|PGLE_CAMJE UDP-N-acetylbacillosamine transaminase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglE PE=1 SV=1 5 162 1.0E-13
sp|Q9XCW4|VIOA_ECOLX dTDP-4-amino-4,6-dideoxy-D-glucose transaminase OS=Escherichia coli GN=vioA PE=1 SV=1 3 120 2.0E-12
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6757
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1733
Ophiocordyceps australis 1348a (Ghana) OphauG2|1734 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1764
Ophiocordyceps subramaniannii Hirsu2|7928

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1734
MHGLKHALVCSSGTVAILHMFEALDLRPGDQVLCPVYTFFATASPLLQYGAVPVFCDSLDDGNLDPAEILTRSTA
RTKAVIVTHMWGLPCRMQEIVDNARKVGIKVLEDCSHAHGAMVNGKLVGSWGDMAAWSLQAKKNVMGGQAGVMAT
NSTDYYSRAVLHGHFNKRAKDDVPADHALRKFWLTGLGLNLRAHPLAIALANQQTNLLPTHDHNRQTYASYMATR
LSAIPFLKMPAVHNKQHDKHAWYAFVMQFDAANAPPGLTRDVFVRKLVDEHGLSEVDIPRSTGLLNELPLFTHSH
EAIPRFGSQPWAQVQPTTQFPRADAFFKAAIKLPVWATKADEHIVKHYVDKILLVAREFAKPADGPKDGNTRSSE
RVVARL*
Coding >OphauG2|1734
ATGCACGGCCTCAAGCACGCCCTGGTCTGCAGCTCTGGCACCGTGGCCATTCTGCACATGTTTGAGGCGCTTGAT
CTCCGGCCTGGCGACCAAGTCCTGTGTCCCGTCTACACCTTTTTTGCCACGGCATCGCCCCTGTTGCAGTATGGC
GCCGTGCCCGTCTTTTGCGACTCGCTCGACGACGGCAACCTGGACCCTGCCGAGATTCTGACGCGCTCTACTGCC
CGAACAAAGGCGGTGATTGTTACGCACATGTGGGGCCTGCCGTGCCGCATGCAAGAGATTGTTGACAATGCTCGC
AAGGTTGGCATCAAGGTGCTCGAGGATTGCTCTCATGCTCATGGCGCAATGGTCAATGGCAAGCTTGTCGGCTCC
TGGGGCGACATGGCGGCCTGGTCCTTGCAGGCCAAGAAGAATGTCATGGGCGGCCAGGCGGGCGTCATGGCCACA
AACTCGACCGACTACTACTCTCGCGCTGTGCTTCACGGCCACTTTAACAAGCGGGCCAAGGACGATGTGCCCGCC
GACCACGCGCTGCGCAAGTTTTGGCTCACCGGCCTTGGCCTCAACCTCCGCGCTCACCCCCTCGCCATTGCCCTT
GCCAACCAACAAACAAACCTCCTCCCCACCCACGACCACAACCGCCAAACCTACGCCTCCTACATGGCCACGCGG
CTCTCCGCCATTCCCTTTCTCAAAATGCCCGCCGTCCACAACAAGCAGCACGACAAGCACGCCTGGTATGCCTTT
GTCATGCAGTTCGACGCGGCCAATGCTCCCCCCGGCCTCACCCGCGACGTCTTTGTCCGCAAGCTTGTAGACGAA
CATGGGCTTTCAGAAGTTGACATTCCGCGCTCTACTGGCCTCTTGAATGAGCTGCCGCTGTTTACACACTCGCAC
GAGGCTATTCCCAGATTTGGGTCCCAGCCTTGGGCCCAGGTCCAGCCGACGACGCAGTTTCCGCGCGCCGATGCC
TTCTTTAAAGCCGCCATCAAGTTGCCTGTTTGGGCCACCAAGGCTGATGAGCATATTGTGAAGCACTACGTGGAC
AAGATTTTGCTTGTTGCTCGAGAGTTTGCCAAGCCGGCCGACGGGCCCAAGGATGGCAACACTCGTTCTAGCGAG
CGTGTAGTTGCCAGGCTGTAG
Transcript >OphauG2|1734
ATGCACGGCCTCAAGCACGCCCTGGTCTGCAGCTCTGGCACCGTGGCCATTCTGCACATGTTTGAGGCGCTTGAT
CTCCGGCCTGGCGACCAAGTCCTGTGTCCCGTCTACACCTTTTTTGCCACGGCATCGCCCCTGTTGCAGTATGGC
GCCGTGCCCGTCTTTTGCGACTCGCTCGACGACGGCAACCTGGACCCTGCCGAGATTCTGACGCGCTCTACTGCC
CGAACAAAGGCGGTGATTGTTACGCACATGTGGGGCCTGCCGTGCCGCATGCAAGAGATTGTTGACAATGCTCGC
AAGGTTGGCATCAAGGTGCTCGAGGATTGCTCTCATGCTCATGGCGCAATGGTCAATGGCAAGCTTGTCGGCTCC
TGGGGCGACATGGCGGCCTGGTCCTTGCAGGCCAAGAAGAATGTCATGGGCGGCCAGGCGGGCGTCATGGCCACA
AACTCGACCGACTACTACTCTCGCGCTGTGCTTCACGGCCACTTTAACAAGCGGGCCAAGGACGATGTGCCCGCC
GACCACGCGCTGCGCAAGTTTTGGCTCACCGGCCTTGGCCTCAACCTCCGCGCTCACCCCCTCGCCATTGCCCTT
GCCAACCAACAAACAAACCTCCTCCCCACCCACGACCACAACCGCCAAACCTACGCCTCCTACATGGCCACGCGG
CTCTCCGCCATTCCCTTTCTCAAAATGCCCGCCGTCCACAACAAGCAGCACGACAAGCACGCCTGGTATGCCTTT
GTCATGCAGTTCGACGCGGCCAATGCTCCCCCCGGCCTCACCCGCGACGTCTTTGTCCGCAAGCTTGTAGACGAA
CATGGGCTTTCAGAAGTTGACATTCCGCGCTCTACTGGCCTCTTGAATGAGCTGCCGCTGTTTACACACTCGCAC
GAGGCTATTCCCAGATTTGGGTCCCAGCCTTGGGCCCAGGTCCAGCCGACGACGCAGTTTCCGCGCGCCGATGCC
TTCTTTAAAGCCGCCATCAAGTTGCCTGTTTGGGCCACCAAGGCTGATGAGCATATTGTGAAGCACTACGTGGAC
AAGATTTTGCTTGTTGCTCGAGAGTTTGCCAAGCCGGCCGACGGGCCCAAGGATGGCAACACTCGTTCTAGCGAG
CGTGTAGTTGCCAGGCTGTAG
Gene >OphauG2|1734
ATGCACGGCCTCAAGCACGCCCTGGTCTGCAGCTCTGGCACCGTGGCCATTCTGCACATGTTTGAGGCGCTTGAT
CTCCGGCCTGGCGACCAAGTCCTGTGTCCCGTCTACACCTTTTTTGCCACGGCATCGCCCCTGTTGCAGTATGGC
GCCGTGCCCGTCTTTTGCGACTCGCTCGACGACGGCAACCTGGACCCTGCCGAGATTCTGACGCGCTCTACTGCC
CGAACAAAGGCGGTGATTGTTACGCACATGTGGGGCCTGCCGTGCCGCATGCAAGAGATTGTTGACAATGCTCGC
AAGGTTGGCATCAAGGTGCTCGAGGATTGCTCTCATGCTCATGGCGCAATGGTCAATGGCAAGCTTGTCGGCTCC
TGGGGCGACATGGCGGCCTGGTCCTTGCAGGCCAAGAAGAATGTCATGGGCGGCCAGGCGGGCGTCATGGCCACA
AACTCGACCGACTACTACTCTCGCGCTGTGCTTCACGGCCACTTTAACAAGCGGGCCAAGGACGATGTGCCCGCC
GACCACGCGCTGCGCAAGTTTTGGCGTACGTTGTTTCTTTTCGTCTTTGCTCCTTCACTCTCTGCTCCTCACCCC
CTTGCTCTTCCACTCTCTATGCCACTCTCTTTGCTCCTTTACTCTCTTTGCTCCTTTACTCTCTTTGCTCTTTTA
CTCTCTTTGCTCTTTTACTCGTCCCTAGACCGTCCCTAGACCATGGCTAACAAGTCAGTCACCGGCCTTGGCCTC
AACCTCCGCGCTCACCCCCTCGCCATTGCCCTTGCCAACCAACAAACAAACCTCCTCCCCACCCACGACCACAAC
CGCCAAACCTACGCCTCCTACATGGCCACGCGGCTCTCCGCCATTCCCTTTCTCAAAATGCCCGCCGTCCACAAC
AAGCAGCACGACAAGCACGCCTGGTATGCCTTTGTCATGCAGTTCGACGCGGCCAATGCTCCCCCCGGCCTCACC
CGCGACGTCTTTGTCCGCAAGCTTGTAGACGAACATGGGCTTTCAGAAGTTGACATTCCGCGCTCTACTGGCCTC
TTGAATGAGCTGCCGCTGTTTACACACTCGCACGAGGCTATTCCCAGATTTGGGTCCCAGCCTTGGGCCCAGGTC
CAGCCGACGACGCAGTTTCCGCGCGCCGATGCCTTCTTTAAAGCCGCCATCAAGTTGCCTGTTTGGGCCACCAAG
GCTGATGAGCATATTGTGAAGCACTACGTGGACAAGATTTTGCTTGTTGCTCGAGAGTTTGCCAAGCCGGCCGAC
GGGCCCAAGGATGGCAACACTCGTTCTAGCGAGCGTGTAGTTGCCAGGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail