Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1721
Gene name
LocationContig_1541:85..1522
Strand-
Gene length (bp)1437
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup377
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1721 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|6957
Ophiocordyceps australis map64 (Brazil) OphauB2|7725
Ophiocordyceps camponoti-floridani Ophcf2|05576
Ophiocordyceps camponoti-rufipedis Ophun1|7602
Ophiocordyceps kimflemingae Ophio5|2612
Ophiocordyceps subramaniannii Hirsu2|1069
Ophiocordyceps subramaniannii Hirsu2|5673
Ophiocordyceps subramaniannii Hirsu2|5701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1721
MESMKLHMLPMEILDMIYQHLNLEDLKTFSLCQHRFRDISERRIFERVIVSWDRAEVASSAIPFLGAILERPELA
TYVHTLRLVGGNYLAPVKRRVPYEILVKASEAIIATRMPDSDIWVQKLQAGSVDAVTTLLLVLLPNLTCIHQASP
FCFDNEMLAKMLTHALSESAHDYQLPDFRKLNKFIVGYADTRETIRDEIRTTNIAENLLPVFRLPSLEHLHIGIP
EETKAWPGVLPTCSSLIEFGLAQYETHGDKALLATMPSLKRFSWQWHNNLRWNRHLGGLNLDEADRALASVSDQL
TYLGISLNYDRGDSEQMDGGVHIFGSLNTLPTMNNLTTLRFPWVFLMGTTNTYGNQFQSRIWSKLPESLIFLDMW
PDLEDFKMDFKWGSSEAIQIMIRELEDRRDRSLMPKLETVRVPVPFKYSHWMDLVSEWRDNRIPYTRRTYGELSH
TIGLKVRGRSSTTSSRNRYFYQMQRPSI*
Coding >OphauG2|1721
ATGGAGTCCATGAAGCTCCATATGCTCCCCATGGAGATCCTCGACATGATTTATCAGCATCTTAATCTTGAGGAT
TTGAAAACATTCAGCTTGTGCCAACATCGGTTTCGAGACATTTCCGAAAGGCGTATTTTTGAGAGGGTTATAGTC
TCGTGGGATCGAGCAGAAGTAGCATCGAGCGCTATTCCATTCCTTGGCGCAATCTTGGAGAGGCCGGAGCTGGCC
ACCTATGTCCATACCCTCCGCCTCGTTGGGGGCAATTACTTGGCTCCCGTCAAGCGCAGGGTTCCTTATGAAATT
CTTGTCAAGGCAAGCGAGGCTATCATAGCAACACGGATGCCCGACTCGGATATCTGGGTGCAAAAGCTTCAAGCC
GGAAGTGTGGATGCTGTCACTACTTTGCTTTTGGTGCTACTGCCCAATCTCACATGCATACACCAAGCAAGTCCC
TTTTGTTTTGACAATGAGATGCTGGCCAAAATGTTGACTCACGCCTTGTCTGAGTCGGCCCACGACTATCAGCTT
CCGGATTTTCGCAAGCTCAACAAATTTATTGTTGGCTACGCAGACACCAGGGAAACCATTCGAGACGAAATTAGA
ACGACCAATATCGCAGAGAATCTACTTCCGGTCTTCCGCTTGCCGTCGCTTGAACACCTGCACATTGGCATTCCC
GAAGAGACTAAGGCCTGGCCTGGAGTCCTGCCAACATGCTCTTCTCTTATCGAATTTGGTCTGGCCCAGTACGAA
ACCCATGGCGATAAGGCTTTGCTTGCCACAATGCCTAGTCTTAAGAGATTCTCCTGGCAGTGGCATAATAATCTT
CGCTGGAACCGACACTTGGGCGGCCTCAACCTAGATGAGGCTGACCGCGCATTGGCTTCCGTTAGCGACCAGCTC
ACCTATCTCGGAATATCATTGAATTACGACCGTGGCGACAGTGAGCAAATGGATGGTGGGGTCCATATATTTGGA
TCGTTGAACACCCTGCCCACGATGAATAATCTTACAACTTTGCGTTTTCCCTGGGTCTTTCTTATGGGAACTACC
AATACATATGGTAACCAATTCCAATCTCGTATCTGGAGCAAGCTACCAGAGAGCCTCATATTCCTCGATATGTGG
CCTGACCTGGAAGATTTCAAGATGGACTTTAAATGGGGCTCTAGCGAGGCTATTCAAATCATGATTCGGGAACTA
GAGGATCGACGGGATCGCTCGCTGATGCCAAAATTGGAGACGGTTAGAGTTCCAGTCCCTTTTAAATACAGTCAC
TGGATGGACCTTGTCAGCGAATGGAGGGATAATCGTATTCCTTATACGAGGAGGACATATGGGGAGCTCAGCCAT
ACTATTGGACTCAAGGTCCGAGGACGAAGCAGCACAACCAGTTCCCGGAACCGTTATTTTTACCAAATGCAAAGG
CCTTCTATTTAA
Transcript >OphauG2|1721
ATGGAGTCCATGAAGCTCCATATGCTCCCCATGGAGATCCTCGACATGATTTATCAGCATCTTAATCTTGAGGAT
TTGAAAACATTCAGCTTGTGCCAACATCGGTTTCGAGACATTTCCGAAAGGCGTATTTTTGAGAGGGTTATAGTC
TCGTGGGATCGAGCAGAAGTAGCATCGAGCGCTATTCCATTCCTTGGCGCAATCTTGGAGAGGCCGGAGCTGGCC
ACCTATGTCCATACCCTCCGCCTCGTTGGGGGCAATTACTTGGCTCCCGTCAAGCGCAGGGTTCCTTATGAAATT
CTTGTCAAGGCAAGCGAGGCTATCATAGCAACACGGATGCCCGACTCGGATATCTGGGTGCAAAAGCTTCAAGCC
GGAAGTGTGGATGCTGTCACTACTTTGCTTTTGGTGCTACTGCCCAATCTCACATGCATACACCAAGCAAGTCCC
TTTTGTTTTGACAATGAGATGCTGGCCAAAATGTTGACTCACGCCTTGTCTGAGTCGGCCCACGACTATCAGCTT
CCGGATTTTCGCAAGCTCAACAAATTTATTGTTGGCTACGCAGACACCAGGGAAACCATTCGAGACGAAATTAGA
ACGACCAATATCGCAGAGAATCTACTTCCGGTCTTCCGCTTGCCGTCGCTTGAACACCTGCACATTGGCATTCCC
GAAGAGACTAAGGCCTGGCCTGGAGTCCTGCCAACATGCTCTTCTCTTATCGAATTTGGTCTGGCCCAGTACGAA
ACCCATGGCGATAAGGCTTTGCTTGCCACAATGCCTAGTCTTAAGAGATTCTCCTGGCAGTGGCATAATAATCTT
CGCTGGAACCGACACTTGGGCGGCCTCAACCTAGATGAGGCTGACCGCGCATTGGCTTCCGTTAGCGACCAGCTC
ACCTATCTCGGAATATCATTGAATTACGACCGTGGCGACAGTGAGCAAATGGATGGTGGGGTCCATATATTTGGA
TCGTTGAACACCCTGCCCACGATGAATAATCTTACAACTTTGCGTTTTCCCTGGGTCTTTCTTATGGGAACTACC
AATACATATGGTAACCAATTCCAATCTCGTATCTGGAGCAAGCTACCAGAGAGCCTCATATTCCTCGATATGTGG
CCTGACCTGGAAGATTTCAAGATGGACTTTAAATGGGGCTCTAGCGAGGCTATTCAAATCATGATTCGGGAACTA
GAGGATCGACGGGATCGCTCGCTGATGCCAAAATTGGAGACGGTTAGAGTTCCAGTCCCTTTTAAATACAGTCAC
TGGATGGACCTTGTCAGCGAATGGAGGGATAATCGTATTCCTTATACGAGGAGGACATATGGGGAGCTCAGCCAT
ACTATTGGACTCAAGGTCCGAGGACGAAGCAGCACAACCAGTTCCCGGAACCGTTATTTTTACCAAATGCAAAGG
CCTTCTATTTAA
Gene >OphauG2|1721
ATGGAGTCCATGAAGCTCCATATGCTCCCCATGGAGATCCTCGACATGATTTATCAGCATCTTAATCTTGAGGAT
TTGAAAACATTCAGCTTGTGCCAACATCGGTTTCGAGACATTTCCGAAAGGCGTATTTTTGAGAGGGTTATAGTC
TCGTGGGATCGAGCAGAAGTAGCATCGAGCGCTATTCCATTCCTTGGCGCAATCTTGGAGAGGCCGGAGCTGGCC
ACCTATGTCCATACCCTCCGCCTCGTTGGGGGCAATTACTTGGCTCCCGTCAAGCGCAGGGTTCCTTATGAAATT
CTTGTCAAGGCAAGCGAGGCTATCATAGCAACACGGATGCCCGACTCGGATATCTGGGTGCAAAAGCTTCAAGCC
GGAAGTGTGGATGCTGTCACTACTTTGCTTTTGGTGCTACTGCCCAATCTCACATGCATACACCAAGCAAGTCCC
TTTTGTTTTGACAATGAGATGCTGGCCAAAATGTTGACTCACGCCTTGTCTGAGTCGGCCCACGACTATCAGCTT
CCGGATTTTCGCAAGCTCAACAAATTTATTGTTGGCTACGCAGACACCAGGGAAACCATTCGAGACGAAATTAGA
ACGACCAATATCGCAGAGAATCTACTTCCGGTCTTCCGCTTGCCGTCGCTTGAACACCTGCACATTGGCATTCCC
GAAGAGACTAAGGCCTGGCCTGGAGTCCTGCCAACATGCTCTTCTCTTATCGAATTTGGTCTGGCCCAGTACGAA
ACCCATGGCGATAAGGCTTTGCTTGCCACAATGCCTAGTCTTAAGAGATTCTCCTGGCAGTGGCATAATAATCTT
CGCTGGAACCGACACTTGGGCGGCCTCAACCTAGATGAGGCTGACCGCGCATTGGCTTCCGTTAGCGACCAGCTC
ACCTATCTCGGAATATCATTGAATTACGACCGTGGCGACAGTGAGCAAATGGATGGTGGGGTCCATATATTTGGA
TCGTTGAACACCCTGCCCACGATGAATAATCTTACAACTTTGCGTTTTCCCTGGGTCTTTCTTATGGGAACTACC
AATACATATGGTAACCAATTCCAATCTCGTATCTGGAGCAAGCTACCAGAGAGCCTCATATTCCTCGATATGTGG
CCTGACCTGGAAGATTTCAAGATGGACTTTAAATGGGGCTCTAGCGAGGCTATTCAAATCATGATTCGGGAACTA
GAGGATCGACGGGATCGCTCGCTGATGCCAAAATTGGAGACGGTTAGAGTTCCAGTCCCTTTTAAATACAGTCAC
TGGATGGACCTTGTCAGCGAATGGAGGGATAATCGTATTCCTTATACGAGGAGGACATATGGGGAGCTCAGCCAT
ACTATTGGACTCAAGGTCCGAGGACGAAGCAGCACAACCAGTTCCCGGAACCGTTATTTTTACCAAATGCAAAGG
CCTTCTATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail