Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1715
Gene name
LocationContig_154:16015..19470
Strand+
Gene length (bp)3455
Transcript length (bp)3135
Coding sequence length (bp)3135
Protein length (aa) 1045

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08689 Med5 Mediator complex subunit Med5 9.6E-79 313 894

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CXW3|MED5_NEOFI Mediator of RNA polymerase II transcription subunit 5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nut1 PE=3 SV=2 32 959 3.0E-170
sp|Q4WNQ6|MED5_ASPFU Mediator of RNA polymerase II transcription subunit 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nut1 PE=3 SV=2 32 1027 3.0E-169
sp|Q1E024|MED5_COCIM Mediator of RNA polymerase II transcription subunit 5 OS=Coccidioides immitis (strain RS) GN=NUT1 PE=3 SV=2 27 960 5.0E-168
sp|Q2UG94|MED5_ASPOR Mediator of RNA polymerase II transcription subunit 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NUT1 PE=3 SV=2 29 983 8.0E-168
sp|Q0CL68|MED5_ASPTN Mediator of RNA polymerase II transcription subunit 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nut1 PE=3 SV=2 29 1031 2.0E-166
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CXW3|MED5_NEOFI Mediator of RNA polymerase II transcription subunit 5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nut1 PE=3 SV=2 32 959 3.0E-170
sp|Q4WNQ6|MED5_ASPFU Mediator of RNA polymerase II transcription subunit 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nut1 PE=3 SV=2 32 1027 3.0E-169
sp|Q1E024|MED5_COCIM Mediator of RNA polymerase II transcription subunit 5 OS=Coccidioides immitis (strain RS) GN=NUT1 PE=3 SV=2 27 960 5.0E-168
sp|Q2UG94|MED5_ASPOR Mediator of RNA polymerase II transcription subunit 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=NUT1 PE=3 SV=2 29 983 8.0E-168
sp|Q0CL68|MED5_ASPTN Mediator of RNA polymerase II transcription subunit 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nut1 PE=3 SV=2 29 1031 2.0E-166
sp|A1CGW7|MED5_ASPCL Mediator of RNA polymerase II transcription subunit 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nut1 PE=3 SV=2 32 989 1.0E-159
sp|Q5B503|MED5_EMENI Mediator of RNA polymerase II transcription subunit 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nut1 PE=3 SV=2 31 959 1.0E-158
sp|Q0USP2|MED5_PHANO Mediator of RNA polymerase II transcription subunit 5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NUT1 PE=3 SV=3 57 957 2.0E-151
sp|Q6C8D1|MED5_YARLI Mediator of RNA polymerase II transcription subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NUT1 PE=3 SV=2 441 895 2.0E-34
sp|A3M022|MED5_PICST Mediator of RNA polymerase II transcription subunit 5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NUT1 PE=3 SV=2 511 745 7.0E-13
sp|Q4PAB8|MED5_USTMA Mediator of RNA polymerase II transcription subunit 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NUT1 PE=3 SV=1 424 718 2.0E-08
sp|Q6BH05|MED5_DEBHA Mediator of RNA polymerase II transcription subunit 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NUT1 PE=3 SV=2 638 721 2.0E-08
sp|Q6FV36|MED5_CANGA Mediator of RNA polymerase II transcription subunit 5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NUT1 PE=3 SV=1 629 766 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0032991 protein-containing complex No
GO:0006355 regulation of transcription, DNA-templated No
GO:0009889 regulation of biosynthetic process No
GO:0005575 cellular_component No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4591
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1715 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3793
Ophiocordyceps camponoti-floridani Ophcf2|04786
Ophiocordyceps camponoti-rufipedis Ophun1|43
Ophiocordyceps kimflemingae Ophio5|832
Ophiocordyceps subramaniannii Hirsu2|9637

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1715
MESSNPPLDRFTLMELGDDRPNQELVKQSVQEWSHFAYVCLRERIDVPVFKELAIDLYSNYPLPRAYIGHIHLRP
YPKSHVSIDPRTPLYIQVLTQLGYVDAPSILTPLYNFSSMHRRLKQLPPTSANPPGEEHKPALLWDNSAWAEEVF
FYHVIKMIVEGSAYKSAIDAYVLINTVAKWMKLFASVSNAIEADVLGQHKNAFWYEQLDSSRAALVPLVLRLVET
PAIIVLLKQPSGKGIRRNLAEGLARFVPTLPPGTPFTERLEMFRCGTLAEMEPGGKERQAAAKAAMDELIPPNVA
LDNFVISDMAISTTRVGLYIYLNALLIGRPLLQDVSFLAYLQNRHQGETQSSAINLILASFDVLANAVIRNERPK
DAHLLRSFLTNKVPLLLCQLFAPQFSTASSEFCITQALNQVDTSLFPTASLMFDESRSNNPYTESVREDFCTACA
LHGLVQREHVERILGETSMSYEPSLEKFSKAKLVDECLSDPEKIHGLVRSLDNMDGNVGAVCHALVELIRQLCNS
KETMTLKILCSQLAQKPQSLDILLLFEKVSAILDPLCSVLDNWRYDDDQAEYQPVYVEFGAILLLVFTIAYRYNL
APTLLEFSSTESCVLQILVRAHIPRLAAELAEKESEQLSGWIRGLFDSETGGLGDDLMSSCPPQQFYLLAATLFQ
KIVGAYACGQLNDESLKSGMEYMLDTFLLPSLVPAIRFLCESIWVEQKEQRSVIKILQLIIMPSSISAEARAMLS
SVKNLIAKPLEYALRSYQKQDPKNQEIEPLLRALRENLPLSRRTGESEHTDVESWASTPNHGISGGLGHTIQALV
HWGVQNGINAMPPSYTHRQLITACKILGPESVLYLLLEEIRSQTDAGLGSIVYDVAVAMVCAPDVTNESVTLLTG
GQMLDMAGSMALGTAPSRTLRDCLRTEAEGCQELQKRDAALAEMVVRLYRLVEEAMAMPQPQVILEAPGMELDLN
GGAGGLGDAMQGGGMTVDGLDMGMGGAASDLGLAGGGGLETGSDGDLFGGMDTTMDMFGGWDGIDLGGS*
Coding >OphauG2|1715
ATGGAGAGCTCTAACCCGCCTCTTGACCGCTTCACCTTGATGGAGCTTGGAGACGATCGTCCAAACCAAGAGCTA
GTGAAACAGTCAGTCCAGGAATGGAGCCACTTTGCCTACGTGTGCCTGCGAGAGCGGATCGACGTCCCCGTGTTC
AAGGAATTAGCCATCGACTTGTACTCGAACTATCCTCTTCCACGTGCCTATATTGGCCATATTCATCTCCGGCCC
TATCCCAAGTCACACGTCAGCATCGATCCCAGAACTCCCCTGTATATCCAGGTCTTGACGCAGCTGGGCTACGTC
GATGCCCCTTCGATTCTGACGCCCCTCTACAACTTTTCCTCGATGCATCGCCGGTTAAAGCAGCTGCCCCCCACG
AGTGCCAATCCTCCAGGTGAAGAGCACAAGCCTGCCTTGCTATGGGACAACTCTGCCTGGGCCGAAGAAGTCTTT
TTCTACCACGTCATCAAGATGATTGTTGAAGGCTCTGCTTACAAGAGTGCCATTGACGCATATGTCCTCATCAAC
ACCGTGGCCAAGTGGATGAAGCTGTTTGCCTCTGTATCCAATGCAATAGAGGCCGACGTGCTTGGCCAGCACAAG
AATGCCTTCTGGTACGAGCAACTCGATTCGTCTCGCGCAGCTCTTGTTCCCCTCGTCTTGCGTCTGGTGGAAACT
CCCGCCATTATCGTCTTGCTGAAGCAACCATCCGGCAAGGGTATTCGCAGGAATTTGGCCGAGGGACTGGCCAGA
TTTGTACCTACACTCCCTCCTGGCACGCCCTTTACCGAGAGACTGGAAATGTTTCGCTGCGGGACACTCGCAGAA
ATGGAGCCTGGCGGCAAGGAACGACAGGCGGCTGCAAAGGCGGCCATGGACGAGCTGATACCGCCCAACGTTGCC
CTCGACAACTTTGTTATTAGCGACATGGCTATTTCAACTACCCGTGTTGGTCTGTATATCTACTTGAATGCTTTG
CTCATTGGACGCCCCCTCTTGCAGGATGTTTCTTTCCTTGCCTACCTCCAAAACAGACACCAGGGCGAGACACAG
TCTAGCGCAATAAACCTCATCTTGGCCTCGTTTGACGTGCTGGCCAATGCAGTAATACGAAACGAGCGCCCCAAA
GATGCACATTTGCTGCGGTCCTTCTTAACCAATAAAGTTCCACTACTTCTTTGCCAGCTCTTTGCCCCTCAGTTT
TCCACTGCTTCTTCCGAGTTTTGCATTACTCAAGCCCTCAACCAAGTTGACACCAGTCTCTTTCCCACGGCGTCT
CTCATGTTTGACGAGTCGCGGAGCAACAACCCCTACACTGAAAGTGTCAGGGAAGACTTCTGTACCGCCTGCGCC
TTGCACGGCCTGGTTCAAAGAGAACATGTCGAGCGCATCCTGGGCGAGACGTCCATGTCGTACGAGCCGTCGCTA
GAGAAGTTTTCAAAGGCAAAACTTGTCGATGAGTGTCTTTCAGACCCAGAAAAGATTCACGGACTTGTCCGTAGC
CTGGACAATATGGATGGCAATGTTGGGGCGGTATGCCATGCCCTGGTCGAGCTGATACGCCAGCTGTGCAACAGC
AAGGAGACCATGACTCTCAAGATTTTGTGTAGCCAACTAGCACAAAAGCCACAGTCACTGGACATACTACTCCTC
TTTGAAAAGGTGTCGGCCATACTGGATCCTCTGTGCAGCGTGCTGGATAACTGGAGATACGACGACGACCAAGCA
GAGTATCAGCCTGTCTACGTGGAGTTTGGAGCCATCTTATTGCTCGTCTTCACCATTGCCTACCGCTACAACCTA
GCACCGACACTACTTGAATTCTCCTCGACAGAGTCTTGCGTGCTTCAGATTCTTGTTCGGGCGCATATCCCTCGT
CTTGCGGCCGAGCTGGCTGAGAAGGAAAGCGAGCAACTTTCTGGCTGGATCCGAGGCCTCTTTGACAGCGAGACT
GGGGGGCTGGGTGACGACTTGATGTCTTCGTGCCCGCCGCAGCAATTCTACCTGCTTGCCGCCACTTTGTTCCAA
AAGATTGTGGGTGCTTATGCCTGTGGGCAGCTCAACGACGAGAGCCTCAAGAGTGGAATGGAGTACATGCTCGAT
ACATTTTTGCTGCCGTCGCTTGTTCCAGCAATTCGATTTTTATGCGAATCGATTTGGGTGGAACAAAAGGAGCAA
AGGTCCGTCATCAAGATACTACAACTCATCATCATGCCCAGCTCCATCTCGGCCGAGGCTCGGGCGATGCTGTCG
TCTGTCAAGAATCTCATTGCCAAGCCGCTCGAGTACGCGCTGCGGTCCTATCAAAAACAGGATCCGAAGAATCAG
GAGATTGAGCCTCTGCTACGCGCACTGCGGGAAAACTTGCCCTTGTCAAGGCGGACGGGCGAATCCGAGCACACC
GACGTGGAATCTTGGGCCAGCACCCCAAACCATGGGATATCGGGCGGATTGGGGCACACGATACAGGCACTTGTT
CATTGGGGGGTGCAAAACGGCATCAATGCAATGCCGCCCTCGTATACGCACCGACAGCTCATTACGGCATGCAAG
ATTCTCGGGCCGGAAAGCGTGCTTTATTTGCTGCTCGAGGAGATTCGGAGTCAGACAGATGCAGGGCTGGGCAGC
ATCGTCTACGATGTGGCCGTTGCCATGGTGTGCGCACCAGACGTTACTAACGAGTCGGTGACGCTCCTGACGGGC
GGCCAGATGCTTGACATGGCGGGCAGCATGGCTCTGGGGACGGCGCCAAGTCGGACTTTGCGCGACTGCCTTAGG
ACGGAGGCTGAAGGATGCCAGGAGCTGCAGAAACGGGATGCGGCGCTGGCGGAAATGGTGGTGCGGCTCTACCGC
CTAGTGGAGGAGGCCATGGCAATGCCACAGCCTCAAGTGATTCTCGAGGCACCGGGCATGGAGCTGGATCTCAAT
GGCGGGGCCGGCGGCCTCGGCGATGCCATGCAGGGCGGCGGCATGACGGTTGACGGGCTTGACATGGGCATGGGA
GGTGCAGCTTCGGACCTGGGGCTGGCAGGCGGCGGCGGGCTGGAGACTGGGAGCGACGGCGATTTGTTTGGCGGC
ATGGACACCACGATGGATATGTTTGGCGGATGGGACGGCATAGACTTGGGCGGGAGCTGA
Transcript >OphauG2|1715
ATGGAGAGCTCTAACCCGCCTCTTGACCGCTTCACCTTGATGGAGCTTGGAGACGATCGTCCAAACCAAGAGCTA
GTGAAACAGTCAGTCCAGGAATGGAGCCACTTTGCCTACGTGTGCCTGCGAGAGCGGATCGACGTCCCCGTGTTC
AAGGAATTAGCCATCGACTTGTACTCGAACTATCCTCTTCCACGTGCCTATATTGGCCATATTCATCTCCGGCCC
TATCCCAAGTCACACGTCAGCATCGATCCCAGAACTCCCCTGTATATCCAGGTCTTGACGCAGCTGGGCTACGTC
GATGCCCCTTCGATTCTGACGCCCCTCTACAACTTTTCCTCGATGCATCGCCGGTTAAAGCAGCTGCCCCCCACG
AGTGCCAATCCTCCAGGTGAAGAGCACAAGCCTGCCTTGCTATGGGACAACTCTGCCTGGGCCGAAGAAGTCTTT
TTCTACCACGTCATCAAGATGATTGTTGAAGGCTCTGCTTACAAGAGTGCCATTGACGCATATGTCCTCATCAAC
ACCGTGGCCAAGTGGATGAAGCTGTTTGCCTCTGTATCCAATGCAATAGAGGCCGACGTGCTTGGCCAGCACAAG
AATGCCTTCTGGTACGAGCAACTCGATTCGTCTCGCGCAGCTCTTGTTCCCCTCGTCTTGCGTCTGGTGGAAACT
CCCGCCATTATCGTCTTGCTGAAGCAACCATCCGGCAAGGGTATTCGCAGGAATTTGGCCGAGGGACTGGCCAGA
TTTGTACCTACACTCCCTCCTGGCACGCCCTTTACCGAGAGACTGGAAATGTTTCGCTGCGGGACACTCGCAGAA
ATGGAGCCTGGCGGCAAGGAACGACAGGCGGCTGCAAAGGCGGCCATGGACGAGCTGATACCGCCCAACGTTGCC
CTCGACAACTTTGTTATTAGCGACATGGCTATTTCAACTACCCGTGTTGGTCTGTATATCTACTTGAATGCTTTG
CTCATTGGACGCCCCCTCTTGCAGGATGTTTCTTTCCTTGCCTACCTCCAAAACAGACACCAGGGCGAGACACAG
TCTAGCGCAATAAACCTCATCTTGGCCTCGTTTGACGTGCTGGCCAATGCAGTAATACGAAACGAGCGCCCCAAA
GATGCACATTTGCTGCGGTCCTTCTTAACCAATAAAGTTCCACTACTTCTTTGCCAGCTCTTTGCCCCTCAGTTT
TCCACTGCTTCTTCCGAGTTTTGCATTACTCAAGCCCTCAACCAAGTTGACACCAGTCTCTTTCCCACGGCGTCT
CTCATGTTTGACGAGTCGCGGAGCAACAACCCCTACACTGAAAGTGTCAGGGAAGACTTCTGTACCGCCTGCGCC
TTGCACGGCCTGGTTCAAAGAGAACATGTCGAGCGCATCCTGGGCGAGACGTCCATGTCGTACGAGCCGTCGCTA
GAGAAGTTTTCAAAGGCAAAACTTGTCGATGAGTGTCTTTCAGACCCAGAAAAGATTCACGGACTTGTCCGTAGC
CTGGACAATATGGATGGCAATGTTGGGGCGGTATGCCATGCCCTGGTCGAGCTGATACGCCAGCTGTGCAACAGC
AAGGAGACCATGACTCTCAAGATTTTGTGTAGCCAACTAGCACAAAAGCCACAGTCACTGGACATACTACTCCTC
TTTGAAAAGGTGTCGGCCATACTGGATCCTCTGTGCAGCGTGCTGGATAACTGGAGATACGACGACGACCAAGCA
GAGTATCAGCCTGTCTACGTGGAGTTTGGAGCCATCTTATTGCTCGTCTTCACCATTGCCTACCGCTACAACCTA
GCACCGACACTACTTGAATTCTCCTCGACAGAGTCTTGCGTGCTTCAGATTCTTGTTCGGGCGCATATCCCTCGT
CTTGCGGCCGAGCTGGCTGAGAAGGAAAGCGAGCAACTTTCTGGCTGGATCCGAGGCCTCTTTGACAGCGAGACT
GGGGGGCTGGGTGACGACTTGATGTCTTCGTGCCCGCCGCAGCAATTCTACCTGCTTGCCGCCACTTTGTTCCAA
AAGATTGTGGGTGCTTATGCCTGTGGGCAGCTCAACGACGAGAGCCTCAAGAGTGGAATGGAGTACATGCTCGAT
ACATTTTTGCTGCCGTCGCTTGTTCCAGCAATTCGATTTTTATGCGAATCGATTTGGGTGGAACAAAAGGAGCAA
AGGTCCGTCATCAAGATACTACAACTCATCATCATGCCCAGCTCCATCTCGGCCGAGGCTCGGGCGATGCTGTCG
TCTGTCAAGAATCTCATTGCCAAGCCGCTCGAGTACGCGCTGCGGTCCTATCAAAAACAGGATCCGAAGAATCAG
GAGATTGAGCCTCTGCTACGCGCACTGCGGGAAAACTTGCCCTTGTCAAGGCGGACGGGCGAATCCGAGCACACC
GACGTGGAATCTTGGGCCAGCACCCCAAACCATGGGATATCGGGCGGATTGGGGCACACGATACAGGCACTTGTT
CATTGGGGGGTGCAAAACGGCATCAATGCAATGCCGCCCTCGTATACGCACCGACAGCTCATTACGGCATGCAAG
ATTCTCGGGCCGGAAAGCGTGCTTTATTTGCTGCTCGAGGAGATTCGGAGTCAGACAGATGCAGGGCTGGGCAGC
ATCGTCTACGATGTGGCCGTTGCCATGGTGTGCGCACCAGACGTTACTAACGAGTCGGTGACGCTCCTGACGGGC
GGCCAGATGCTTGACATGGCGGGCAGCATGGCTCTGGGGACGGCGCCAAGTCGGACTTTGCGCGACTGCCTTAGG
ACGGAGGCTGAAGGATGCCAGGAGCTGCAGAAACGGGATGCGGCGCTGGCGGAAATGGTGGTGCGGCTCTACCGC
CTAGTGGAGGAGGCCATGGCAATGCCACAGCCTCAAGTGATTCTCGAGGCACCGGGCATGGAGCTGGATCTCAAT
GGCGGGGCCGGCGGCCTCGGCGATGCCATGCAGGGCGGCGGCATGACGGTTGACGGGCTTGACATGGGCATGGGA
GGTGCAGCTTCGGACCTGGGGCTGGCAGGCGGCGGCGGGCTGGAGACTGGGAGCGACGGCGATTTGTTTGGCGGC
ATGGACACCACGATGGATATGTTTGGCGGATGGGACGGCATAGACTTGGGCGGGAGCTGA
Gene >OphauG2|1715
ATGGAGAGCTCTAACCCGCCTCTTGACCGCTTCACCTTGATGGAGCTTGGAGACGATCGTCCAAACCAAGAGCTA
GTGAAACAGTCAGTCCAGGAATGGAGCCACTTTGCCTACGTGTGCCTGCGAGAGCGGATCGACGTCCCCGTGTTC
AAGGAATTAGCCATCGACTTGTACTCGAACTATCCTCTTCCACGTGCCTATATTGGCCATATTCATCTCCGGCCC
TATCCCAAGTCACACGTCAGCATCGATCCCAGAACTCCCCTGTATATCCAGGTCTTGACGCAGCTGGGCTACGTC
GATGCCCCTTCGATTCTGACGCCCCTCTACAACTTTTCCTCGATGCATCGCCGGTTAAAGCAGCTGCCCCCCACG
AGTGCCAATCCTCCAGGTGAAGAGCACAAGCCTGCCTTGCTATGGGACAACTCTGCCTGGGCCGAAGAAGTCTTT
TTCTACCACGTCATCAAGATGATTGTTGAAGGCTCTGCTTACAAGAGTGCCATTGACGCATATGTCCTCATCAAC
ACCGTGGCCAAGTGGATGAAGCTGTTTGCCTCTGTATCCAATGCAATAGAGGCCGACGTGCTTGGCCAGCACAAG
AATGCCTTCTGGTACGAGCAACTCGATTCGTCTCGCGCAGCTCTTGTTCCCCTCGTCTTGCGTCTGGTGGAAACT
CCCGCCATTATCGTCTTGCTGAAGCAACCATCCGGCAAGGGTATGTCTTGACCCTTTGTCTTTAGCTATTCGTCA
CGCTAACAGGGCTCGCTAGGTATTCGCAGGAATTTGGCCGAGGGACTGGCCAGATTTGTACCTACACTCCCTCCT
GGCACGCCCTTTACCGAGAGACTGGAAATGTTTCGCTGCGGGACACTCGCAGAAATGGAGCCTGGCGGCAAGGAA
CGACAGGCGGCTGCAAAGGCGGCCATGGACGAGCTGATACCGCCCAACGTTGCCCTCGACAACTTTGTTATTAGC
GACATGGCTATTTCAACTACCCGTGTTGGTCTGTATATCTACTTGAATGCTTTGGCAAGTTTTGTTTTGCATTTG
GCACTCGAACGACTGGCTGACCTCGATTACAGCTCATTGGACGCCCCCTCTTGCAGGATGTTTCTTTCCTTGCCT
ACCTCCAAAACAGACACCAGGCAAGTCCCAGCCAGAGCCCCATTCATGTCGTGCCCTGACGGGTGGCTAACATGG
CTTCCAGGGCGAGACACAGTCTAGCGCAATAAACCTCATCTTGGCCTCGTTTGACGTGCTGGCCAATGCAGTAAT
ACGAAACGAGCGCCCCAAAGATGCACATTTGCTGCGGTCCTTCTTAACCAATAAAGTTCCACTACTTCTTTGCCA
GCTCTTTGCCCCTCAGTTTTCCACTGCTTCTTCCGAGTTTTGCATTACTCAAGCCCTCAACCAAGTTGACACCAG
TCTCTTTCCCACGGCGTCTCTCATGTTTGACGAGTCGCGGAGCAACAACCCCTACACTGAAAGTGTCAGGGAAGA
CTTCTGTACCGCCTGCGCCTTGCACGGCCTGGTTCAAAGAGAACATGTCGAGCGCATCCTGGGCGAGACGTCCAT
GTCGTACGAGCCGTCGCTAGAGAAGTTTTCAAAGGCAAAACTTGTCGATGAGTGTCTTTCAGACCCAGAAAAGAT
TCACGGACTTGTCCGTAGCCTGGACAATATGGATGGCAATGTTGGGGCGGTATGCCATGCCCTGGTCGAGGTAAG
AGAAGGCCTTGGCGCTAGCAAGACTAAAGGAAAGGAAATATGGCTAATTCGCGCCCACTGTAGCTGATACGCCAG
CTGTGCAACAGCAAGGAGACCATGACTCTCAAGATTTTGTGTAGCCAACTAGCACAAAAGCCACAGTCACTGGAC
ATACTACTCCTCTTTGAAAAGGTGTCGGCCATACTGGATCCTCTGTGCAGCGTGCTGGATAACTGGAGATACGAC
GACGACCAAGCAGAGTATCAGCCTGTCTACGTGGAGTTTGGAGCCATCTTATTGCTCGTCTTCACCATTGCCTAC
CGCTACAACCTAGCACCGACACTACTTGAATTCTCCTCGACAGAGTCTTGCGTGCTTCAGATTCTTGTTCGGGCG
CATATCCCTCGTCTTGCGGCCGAGCTGGCTGAGAAGGAAAGCGAGCAACTTTCTGGCTGGATCCGAGGCCTCTTT
GACAGCGAGACTGGGGGGCTGGGTGACGACTTGATGTCTTCGTGCCCGCCGCAGCAATTCTACCTGCTTGCCGCC
ACTTTGTTCCAAAAGATTGTGGGTGCTTATGCCTGTGGGCAGCTCAACGACGAGAGCCTCAAGAGTGGAATGGAG
TGTAAGTGGCAAGACTGCGAAACCGGTGGCGCTGGGCACAAGGCGGGCATGAGCTGGCGTGAGCTGACATGAATG
GGCGGGCAGACATGCTCGATACATTTTTGCTGCCGTCGCTTGTTCCAGCAATTCGATTTTTATGCGAATCGATTT
GGGTGGAACAAAAGGAGCAAAGGTCCGTCATCAAGATACTACAACTCATCATCATGCCCAGCTCCATCTCGGCCG
AGGCTCGGGCGATGCTGTCGTCTGTCAAGAATCTCATTGCCAAGCCGCTCGAGTACGCGCTGCGGTCCTATCAAA
AACAGGATCCGAAGAATCAGGAGATTGAGCCTCTGCTACGCGCACTGCGGGAAAACTTGCCCTTGTCAAGGCGGA
CGGGCGAATCCGAGCACACCGACGTGGAATCTTGGGCCAGCACCCCAAACCATGGGATATCGGGCGGATTGGGGC
ACACGATACAGGCACTTGTTCATTGGGGGGTGCAAAACGGCATCAATGCAATGCCGCCCTCGTATACGCACCGAC
AGCTCATTACGGCATGCAAGATTCTCGGGCCGGAAAGCGTGCTTTATTTGCTGCTCGAGGAGATTCGGAGTCAGA
CAGATGCAGGGCTGGGCAGCATCGTCTACGATGTGGCCGTTGCCATGGTGTGCGCACCAGACGTTACTAACGAGT
CGGTGACGCTCCTGACGGGCGGCCAGATGCTTGACATGGCGGGCAGCATGGCTCTGGGGACGGCGCCAAGTCGGA
CTTTGCGCGACTGCCTTAGGACGGAGGCTGAAGGATGCCAGGAGCTGCAGAAACGGGATGCGGCGCTGGCGGAAA
TGGTGGTGCGGCTCTACCGCCTAGTGGAGGAGGCCATGGCAATGCCACAGCCTCAAGTGATTCTCGAGGCACCGG
GCATGGAGCTGGATCTCAATGGCGGGGCCGGCGGCCTCGGCGATGCCATGCAGGGCGGCGGCATGACGGTTGACG
GGCTTGACATGGGCATGGGAGGTGCAGCTTCGGACCTGGGGCTGGCAGGCGGCGGCGGGCTGGAGACTGGGAGCG
ACGGCGATTTGTTTGGCGGCATGGACACCACGATGGATATGTTTGGCGGATGGGACGGCATAGACTTGGGCGGGA
GCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail