Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1713
Gene name
LocationContig_154:12446..13248
Strand+
Gene length (bp)802
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 5.5E-08 136 162
PF13499 EF-hand_7 EF-hand domain pair 4.6E-07 24 80
PF13499 EF-hand_7 EF-hand domain pair 3.8E-14 93 160
PF13405 EF-hand_6 EF-hand domain 1.7E-05 94 122
PF13202 EF-hand_5 EF hand 1.3E-04 26 48
PF13202 EF-hand_5 EF hand 1.4E-02 98 115
PF13202 EF-hand_5 EF hand 3.3E-07 137 160
PF13833 EF-hand_8 EF-hand domain pair 7.4E-04 70 116
PF13833 EF-hand_8 EF-hand domain pair 1.3E-05 124 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 1 173 2.0E-115
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 1 174 4.0E-84
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 1 174 4.0E-84
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 1 171 8.0E-83
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 1 173 7.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87072|CANB_NEUCR Calcineurin subunit B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cnb-1 PE=2 SV=2 1 173 2.0E-115
sp|P0CM54|CANB_CRYNJ Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB1 PE=2 SV=1 1 174 4.0E-84
sp|P0CM55|CANB_CRYNB Calcineurin subunit B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNB1 PE=3 SV=1 1 174 4.0E-84
sp|Q757B7|CANB_ASHGO Calcineurin subunit B OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CNB1 PE=3 SV=1 1 171 8.0E-83
sp|Q874T7|CANB_KLULA Calcineurin subunit B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CNB1 PE=3 SV=1 1 173 7.0E-82
sp|Q9UU93|CANB_SCHPO Calcineurin subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnb1 PE=3 SV=1 1 172 2.0E-81
sp|P25296|CANB_YEAST Calcineurin subunit B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNB1 PE=1 SV=3 1 171 4.0E-81
sp|Q6BWS8|CANB_DEBHA Calcineurin subunit B OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CNB1 PE=3 SV=1 1 174 4.0E-81
sp|Q6FLU4|CANB_CANGA Calcineurin subunit B OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CNB1 PE=3 SV=1 1 171 9.0E-81
sp|Q6CGE6|CANB_YARLI Calcineurin subunit B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CNB1 PE=3 SV=1 9 172 2.0E-79
sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 1 172 8.0E-68
sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 1 172 8.0E-68
sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 1 172 8.0E-68
sp|P63099|CANB1_BOVIN Calcineurin subunit B type 1 OS=Bos taurus GN=PPP3R1 PE=1 SV=2 1 172 8.0E-68
sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster GN=CanB PE=2 SV=1 1 172 1.0E-67
sp|P42322|CANB1_NAEGR Calcineurin subunit B OS=Naegleria gruberi GN=CNB1 PE=3 SV=1 1 171 1.0E-67
sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster GN=CanB2 PE=1 SV=2 1 172 6.0E-67
sp|P28470|CANB2_RAT Calcineurin subunit B type 2 OS=Rattus norvegicus GN=Ppp3r2 PE=2 SV=2 1 171 5.0E-61
sp|Q96LZ3|CANB2_HUMAN Calcineurin subunit B type 2 OS=Homo sapiens GN=PPP3R2 PE=1 SV=3 1 171 1.0E-60
sp|Q2TBI5|CANB2_BOVIN Calcineurin subunit B type 2 OS=Bos taurus GN=PPP3R2 PE=2 SV=3 1 170 1.0E-59
sp|Q63811|CANB2_MOUSE Calcineurin subunit B type 2 OS=Mus musculus GN=Ppp3r2 PE=1 SV=3 16 171 2.0E-59
sp|Q55G87|CANB1_DICDI Calcineurin subunit B type 1 OS=Dictyostelium discoideum GN=cnbA PE=1 SV=1 1 160 3.0E-55
sp|Q54MF3|CANB2_DICDI Calcineurin subunit B type 2 OS=Dictyostelium discoideum GN=cnbB PE=3 SV=1 18 156 6.0E-37
sp|Q5R7F0|CHP1_PONAB Calcineurin B homologous protein 1 OS=Pongo abelii GN=CHP1 PE=2 SV=3 1 171 1.0E-34
sp|Q99653|CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens GN=CHP1 PE=1 SV=3 1 171 1.0E-34
sp|Q3SYS6|CHP1_BOVIN Calcineurin B homologous protein 1 OS=Bos taurus GN=CHP1 PE=2 SV=1 1 171 1.0E-34
sp|P61023|CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus GN=Chp1 PE=1 SV=2 1 171 1.0E-34
sp|P61022|CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus GN=Chp1 PE=1 SV=2 1 171 1.0E-34
sp|Q5ZM44|CHP1_CHICK Calcineurin B homologous protein 1 OS=Gallus gallus GN=CHP1 PE=1 SV=3 16 171 2.0E-34
sp|O43745|CHP2_HUMAN Calcineurin B homologous protein 2 OS=Homo sapiens GN=CHP2 PE=1 SV=3 1 171 8.0E-31
sp|Q9D869|CHP2_MOUSE Calcineurin B homologous protein 2 OS=Mus musculus GN=Chp2 PE=2 SV=4 1 171 2.0E-29
sp|Q810D1|CHP2_RAT Calcineurin B homologous protein 2 OS=Rattus norvegicus GN=Chp2 PE=1 SV=1 1 171 6.0E-29
sp|O75838|CIB2_HUMAN Calcium and integrin-binding family member 2 OS=Homo sapiens GN=CIB2 PE=1 SV=1 1 160 2.0E-23
sp|Q9Z309|CIB2_MOUSE Calcium and integrin-binding family member 2 OS=Mus musculus GN=Cib2 PE=1 SV=1 1 160 2.0E-22
sp|Q568Z7|CIB2_RAT Calcium and integrin-binding family member 2 OS=Rattus norvegicus GN=Cib2 PE=2 SV=1 1 160 3.0E-22
sp|C7A276|CIB2_SHEEP Calcium and integrin-binding family member 2 (Fragment) OS=Ovis aries GN=CIB2 PE=2 SV=1 18 160 1.0E-20
sp|Q5R6S5|HPCL4_PONAB Hippocalcin-like protein 4 OS=Pongo abelii GN=HPCAL4 PE=2 SV=3 1 171 2.0E-20
sp|Q9UM19|HPCL4_HUMAN Hippocalcin-like protein 4 OS=Homo sapiens GN=HPCAL4 PE=1 SV=3 1 171 2.0E-20
sp|P29104|HPCL4_BOVIN Hippocalcin-like protein 4 OS=Bos taurus GN=HPCAL4 PE=1 SV=3 1 171 2.0E-20
sp|P37236|FREQ_DROME Frequenin-1 OS=Drosophila melanogaster GN=Frq1 PE=2 SV=2 1 158 6.0E-20
sp|Q8BGZ1|HPCL4_MOUSE Hippocalcin-like protein 4 OS=Mus musculus GN=Hpcal4 PE=1 SV=3 5 171 1.0E-19
sp|P35332|HPCL4_RAT Hippocalcin-like protein 4 OS=Rattus norvegicus GN=Hpcal4 PE=2 SV=2 1 171 2.0E-19
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 6 156 3.0E-19
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 20 160 5.0E-19
sp|Q6AXL4|NCLDB_DANRE Neurocalcin-delta B OS=Danio rerio GN=ncaldb PE=2 SV=1 1 156 1.0E-18
sp|A9JTH1|NCLDA_DANRE Neurocalcin-delta A OS=Danio rerio GN=ncalda PE=2 SV=1 6 162 3.0E-18
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 21 160 4.0E-18
sp|Q9C5P6|CNBL6_ARATH Calcineurin B-like protein 6 OS=Arabidopsis thaliana GN=CBL6 PE=1 SV=2 11 160 5.0E-18
sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 6 158 5.0E-18
sp|Q5PQN0|NCALD_RAT Neurocalcin-delta OS=Rattus norvegicus GN=Ncald PE=1 SV=3 6 156 7.0E-18
sp|Q91X97|NCALD_MOUSE Neurocalcin-delta OS=Mus musculus GN=Ncald PE=1 SV=4 6 156 7.0E-18
sp|Q4R4N4|NCALD_MACFA Neurocalcin-delta OS=Macaca fascicularis GN=NCALD PE=2 SV=3 6 156 7.0E-18
sp|P61601|NCALD_HUMAN Neurocalcin-delta OS=Homo sapiens GN=NCALD PE=1 SV=2 6 156 7.0E-18
sp|P61602|NCALD_BOVIN Neurocalcin-delta OS=Bos taurus GN=NCALD PE=1 SV=2 6 156 7.0E-18
sp|B5FZ84|HPCL1_TAEGU Hippocalcin-like protein 1 OS=Taeniopygia guttata GN=HPCAL1 PE=2 SV=1 6 158 8.0E-18
sp|P42324|HPCL1_CHICK Hippocalcin-like protein 1 OS=Gallus gallus GN=HPCAL1 PE=1 SV=2 6 158 8.0E-18
sp|Q06389|NCS1_YEAST Calcium-binding protein NCS-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRQ1 PE=1 SV=2 1 158 8.0E-18
sp|Q7SY75|NCALD_XENLA Neurocalcin-delta OS=Xenopus laevis GN=ncald PE=2 SV=1 6 156 8.0E-18
sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 6 158 8.0E-18
sp|B3DLU1|NCALD_XENTR Neurocalcin-delta OS=Xenopus tropicalis GN=ncald PE=2 SV=1 6 156 9.0E-18
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 21 160 9.0E-18
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 20 160 1.0E-17
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 21 160 1.0E-17
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 21 160 1.0E-17
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 21 160 1.0E-17
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 20 160 1.0E-17
sp|P62759|NCALD_TAEGU Neurocalcin-delta OS=Taeniopygia guttata GN=NCALD PE=2 SV=2 6 156 1.0E-17
sp|P62758|NCALD_CHICK Neurocalcin-delta OS=Gallus gallus GN=NCALD PE=2 SV=2 6 156 1.0E-17
sp|Q3HRP0|CNBL7_ORYSJ Calcineurin B-like protein 7 OS=Oryza sativa subsp. japonica GN=CBL7 PE=2 SV=1 12 174 1.0E-17
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 20 160 1.0E-17
sp|Q96Q77|CIB3_HUMAN Calcium and integrin-binding family member 3 OS=Homo sapiens GN=CIB3 PE=1 SV=3 1 160 1.0E-17
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 21 160 1.0E-17
sp|Q75KU4|CNBL4_ORYSJ Calcineurin B-like protein 4 OS=Oryza sativa subsp. japonica GN=CBL4 PE=1 SV=1 12 174 1.0E-17
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 21 160 1.0E-17
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 21 160 1.0E-17
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 21 160 1.0E-17
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 21 160 1.0E-17
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 21 160 1.0E-17
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 21 160 1.0E-17
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 21 160 1.0E-17
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 21 160 1.0E-17
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 21 160 1.0E-17
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 21 160 1.0E-17
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 21 160 1.0E-17
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 21 160 1.0E-17
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 21 160 1.0E-17
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 21 160 1.0E-17
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 21 160 1.0E-17
sp|Q9FUQ7|CNBL8_ARATH Calcineurin B-like protein 8 OS=Arabidopsis thaliana GN=CBL8 PE=1 SV=1 16 174 1.0E-17
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 9 161 2.0E-17
sp|B3VSB7|HPCL1_SHEEP Hippocalcin-like protein 1 OS=Ovis aries GN=HPCAL1 PE=2 SV=1 6 158 2.0E-17
sp|Q06AT0|HPCL1_PIG Hippocalcin-like protein 1 OS=Sus scrofa GN=HPCAL1 PE=2 SV=3 6 158 2.0E-17
sp|P29105|HPCL1_BOVIN Hippocalcin-like protein 1 OS=Bos taurus GN=HPCAL1 PE=1 SV=4 6 158 2.0E-17
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 21 160 2.0E-17
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 21 160 2.0E-17
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 21 160 2.0E-17
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 21 160 2.0E-17
sp|Q5R632|HPCL1_PONAB Hippocalcin-like protein 1 OS=Pongo abelii GN=HPCAL1 PE=2 SV=3 6 158 2.0E-17
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 21 160 2.0E-17
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 21 160 2.0E-17
sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens GN=HPCAL1 PE=1 SV=3 6 156 2.0E-17
sp|Q5RAH1|NCALD_PONAB Neurocalcin-delta OS=Pongo abelii GN=NCALD PE=2 SV=3 6 156 3.0E-17
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 21 160 4.0E-17
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 21 160 4.0E-17
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 20 160 4.0E-17
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 21 162 4.0E-17
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 21 160 4.0E-17
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 21 160 5.0E-17
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 20 160 5.0E-17
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 20 160 5.0E-17
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 20 160 5.0E-17
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 20 160 5.0E-17
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 21 160 5.0E-17
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 21 160 5.0E-17
sp|Q9R010|CIB1_RAT Calcium and integrin-binding protein 1 OS=Rattus norvegicus GN=Cib1 PE=1 SV=3 20 160 5.0E-17
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 21 160 6.0E-17
sp|Q9Z0F4|CIB1_MOUSE Calcium and integrin-binding protein 1 OS=Mus musculus GN=Cib1 PE=1 SV=3 20 160 6.0E-17
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 20 160 6.0E-17
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 21 156 7.0E-17
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 17 160 7.0E-17
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 21 156 7.0E-17
sp|B1A8Z2|CIB1_SHEEP Calcium and integrin-binding protein 1 OS=Ovis aries GN=CIB1 PE=2 SV=1 20 160 7.0E-17
sp|Q17QE5|CIB1_BOVIN Calcium and integrin-binding protein 1 OS=Bos taurus GN=CIB1 PE=2 SV=1 20 160 7.0E-17
sp|Q0P523|CIB3_MOUSE Calcium and integrin-binding family member 3 OS=Mus musculus GN=Cib3 PE=1 SV=1 26 160 9.0E-17
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 13 160 9.0E-17
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 20 160 9.0E-17
sp|P62762|VISL1_RAT Visinin-like protein 1 OS=Rattus norvegicus GN=Vsnl1 PE=1 SV=2 5 171 9.0E-17
sp|Q5RD22|VISL1_PONAB Visinin-like protein 1 OS=Pongo abelii GN=VSNL1 PE=2 SV=3 5 171 9.0E-17
sp|P62761|VISL1_MOUSE Visinin-like protein 1 OS=Mus musculus GN=Vsnl1 PE=1 SV=2 5 171 9.0E-17
sp|Q4R5F7|VISL1_MACFA Visinin-like protein 1 OS=Macaca fascicularis GN=VSNL1 PE=2 SV=3 5 171 9.0E-17
sp|P62760|VISL1_HUMAN Visinin-like protein 1 OS=Homo sapiens GN=VSNL1 PE=1 SV=2 5 171 9.0E-17
sp|P62764|VISL1_CHICK Visinin-like protein 1 OS=Gallus gallus GN=VSNL1 PE=2 SV=2 5 171 9.0E-17
sp|P62763|VISL1_BOVIN Visinin-like protein 1 OS=Bos taurus GN=VSNL1 PE=1 SV=2 5 171 9.0E-17
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 21 160 1.0E-16
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 21 160 1.0E-16
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 21 160 1.0E-16
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 21 160 1.0E-16
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 21 160 1.0E-16
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 21 160 1.0E-16
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 21 160 1.0E-16
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 21 160 1.0E-16
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 21 160 1.0E-16
sp|Q99828|CIB1_HUMAN Calcium and integrin-binding protein 1 OS=Homo sapiens GN=CIB1 PE=1 SV=4 20 160 1.0E-16
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 20 160 1.0E-16
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 21 160 1.0E-16
sp|Q3HRP5|CNBL2_ORYSJ Calcineurin B-like protein 2 OS=Oryza sativa subsp. japonica GN=CBL2 PE=2 SV=1 18 160 1.0E-16
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 20 160 1.0E-16
sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 6 158 1.0E-16
sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=1 SV=2 6 158 1.0E-16
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 8 160 2.0E-16
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 20 160 2.0E-16
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 20 160 2.0E-16
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 21 160 2.0E-16
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 1 158 2.0E-16
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 6 156 2.0E-16
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 20 160 2.0E-16
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 21 160 2.0E-16
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 1 158 2.0E-16
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 1 158 2.0E-16
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 1 158 2.0E-16
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 1 158 2.0E-16
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 20 160 2.0E-16
sp|Q8LAS7|CNBL2_ARATH Calcineurin B-like protein 2 OS=Arabidopsis thaliana GN=CBL2 PE=1 SV=2 18 160 2.0E-16
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 20 160 2.0E-16
sp|Q75LU8|CNBL3_ORYSJ Calcineurin B-like protein 3 OS=Oryza sativa subsp. japonica GN=CBL3 PE=1 SV=1 18 160 2.0E-16
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 26 156 3.0E-16
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 21 160 3.0E-16
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 21 160 3.0E-16
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 21 160 3.0E-16
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 21 160 3.0E-16
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 20 164 3.0E-16
sp|Q3HRP1|CNBL6_ORYSJ Calcineurin B-like protein 6 OS=Oryza sativa subsp. japonica GN=CBL6 PE=2 SV=1 10 160 4.0E-16
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 26 160 4.0E-16
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 21 160 4.0E-16
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 21 160 4.0E-16
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 21 160 4.0E-16
sp|Q3HRN8|CNBL9_ORYSJ Calcineurin B-like protein 9 OS=Oryza sativa subsp. japonica GN=CBL9 PE=2 SV=2 14 174 4.0E-16
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 1 158 4.0E-16
sp|P36608|NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans GN=ncs-1 PE=2 SV=2 5 158 5.0E-16
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 21 160 7.0E-16
sp|Q09711|NCS1_SCHPO Calcium-binding protein NCS-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ncs1 PE=1 SV=2 1 156 7.0E-16
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 17 160 8.0E-16
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 16 163 8.0E-16
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 21 160 9.0E-16
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 21 160 9.0E-16
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 21 160 1.0E-15
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 17 160 1.0E-15
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 21 160 1.0E-15
sp|Q3HRN9|CNBL8_ORYSJ Calcineurin B-like protein 8 OS=Oryza sativa subsp. japonica GN=CBL8 PE=2 SV=1 12 157 1.0E-15
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 21 160 1.0E-15
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 21 160 1.0E-15
sp|Q9C8Y1|CML23_ARATH Probable calcium-binding protein CML23 OS=Arabidopsis thaliana GN=CML23 PE=2 SV=1 23 160 1.0E-15
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 21 160 1.0E-15
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 21 160 1.0E-15
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 21 160 1.0E-15
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 21 160 1.0E-15
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 21 160 1.0E-15
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 21 160 1.0E-15
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 20 160 1.0E-15
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 21 160 1.0E-15
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 21 160 1.0E-15
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 21 160 1.0E-15
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 21 160 1.0E-15
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 21 160 1.0E-15
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 21 160 1.0E-15
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 21 160 1.0E-15
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 13 160 2.0E-15
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 21 160 2.0E-15
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 21 160 2.0E-15
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 1 171 2.0E-15
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 21 160 3.0E-15
sp|Q2V8Y7|NCS1_BOVIN Neuronal calcium sensor 1 OS=Bos taurus GN=NCS1 PE=1 SV=3 1 158 3.0E-15
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 21 160 4.0E-15
sp|Q3HRP2|CNBL5_ORYSJ Calcineurin B-like protein 5 OS=Oryza sativa subsp. japonica GN=CBL5 PE=2 SV=1 16 174 4.0E-15
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 20 160 5.0E-15
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 21 160 5.0E-15
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 21 160 6.0E-15
sp|Q9Y2W7|CSEN_HUMAN Calsenilin OS=Homo sapiens GN=KCNIP3 PE=1 SV=1 9 168 6.0E-15
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 1 160 6.0E-15
sp|O81223|CNBL4_ARATH Calcineurin B-like protein 4 OS=Arabidopsis thaliana GN=CBL4 PE=1 SV=3 16 174 8.0E-15
sp|P84076|HPCA_RAT Neuron-specific calcium-binding protein hippocalcin OS=Rattus norvegicus GN=Hpca PE=1 SV=2 6 156 1.0E-14
sp|Q06AT1|HPCA_PIG Neuron-specific calcium-binding protein hippocalcin OS=Sus scrofa GN=HPCA PE=2 SV=3 6 156 1.0E-14
sp|P84075|HPCA_MOUSE Neuron-specific calcium-binding protein hippocalcin OS=Mus musculus GN=Hpca PE=1 SV=2 6 156 1.0E-14
sp|P84074|HPCA_HUMAN Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens GN=HPCA PE=1 SV=2 6 156 1.0E-14
sp|Q4PL64|HPCA_BOVIN Neuron-specific calcium-binding protein hippocalcin OS=Bos taurus GN=HPCA PE=2 SV=3 6 156 1.0E-14
sp|Q8LEM7|CNBL3_ARATH Calcineurin B-like protein 3 OS=Arabidopsis thaliana GN=CBL3 PE=1 SV=2 18 160 1.0E-14
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 9 161 1.0E-14
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 21 160 1.0E-14
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 21 160 2.0E-14
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 21 160 2.0E-14
sp|P79880|GUC1A_CHICK Guanylyl cyclase-activating protein 1 OS=Gallus gallus GN=GUCA1A PE=1 SV=3 22 165 2.0E-14
sp|O73761|GUC1A_LITPI Guanylyl cyclase-activating protein 1 OS=Lithobates pipiens GN=GUCA1A PE=2 SV=3 22 169 3.0E-14
sp|Q9JM47|CSEN_RAT Calsenilin OS=Rattus norvegicus GN=Kcnip3 PE=1 SV=1 9 168 3.0E-14
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 16 160 3.0E-14
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 21 160 3.0E-14
sp|Q7FZF1|CNBL5_ARATH Calcineurin B-like protein 5 OS=Arabidopsis thaliana GN=CBL5 PE=1 SV=3 18 171 4.0E-14
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 21 162 4.0E-14
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 21 160 4.0E-14
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 21 160 4.0E-14
sp|Q17QD9|CSEN_BOVIN Calsenilin OS=Bos taurus GN=KCNIP3 PE=2 SV=1 9 168 5.0E-14
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 21 168 5.0E-14
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 13 165 5.0E-14
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 21 160 5.0E-14
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 21 160 5.0E-14
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 21 160 5.0E-14
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 21 160 5.0E-14
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 21 160 5.0E-14
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 21 160 6.0E-14
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 21 160 6.0E-14
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 21 160 6.0E-14
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 9 161 7.0E-14
sp|Q2KI69|KCIP4_BOVIN Kv channel-interacting protein 4 OS=Bos taurus GN=KCNIP4 PE=2 SV=1 16 156 8.0E-14
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 21 165 8.0E-14
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 20 160 9.0E-14
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 13 162 1.0E-13
sp|Q3HRN7|CNBLA_ORYSJ Calcineurin B-like protein 10 OS=Oryza sativa subsp. japonica GN=CBL10 PE=2 SV=1 14 160 1.0E-13
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 39 160 2.0E-13
sp|A0PJX0|CIB4_HUMAN Calcium and integrin-binding family member 4 OS=Homo sapiens GN=CIB4 PE=1 SV=1 20 165 2.0E-13
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 39 160 2.0E-13
sp|Q502J0|PCAT2_DANRE Lysophosphatidylcholine acyltransferase 2 OS=Danio rerio GN=lpcat2 PE=2 SV=1 39 157 2.0E-13
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 15 166 2.0E-13
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 13 160 2.0E-13
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 9 157 3.0E-13
sp|Q9D9N5|CIB4_MOUSE Calcium and integrin-binding family member 4 OS=Mus musculus GN=Cib4 PE=2 SV=1 20 165 3.0E-13
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 15 162 3.0E-13
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 17 160 3.0E-13
sp|Q99MG9|KCIP4_RAT Kv channel-interacting protein 4 OS=Rattus norvegicus GN=Kcnip4 PE=1 SV=1 16 156 3.0E-13
sp|Q6PHZ8|KCIP4_MOUSE Kv channel-interacting protein 4 OS=Mus musculus GN=Kcnip4 PE=1 SV=1 16 156 3.0E-13
sp|Q8HYN7|KCIP4_MACFA Kv channel-interacting protein 4 OS=Macaca fascicularis GN=KCNIP4 PE=2 SV=1 16 156 3.0E-13
sp|Q6PIL6|KCIP4_HUMAN Kv channel-interacting protein 4 OS=Homo sapiens GN=KCNIP4 PE=1 SV=1 16 156 3.0E-13
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 13 160 3.0E-13
sp|Q9NS61|KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens GN=KCNIP2 PE=1 SV=3 9 156 3.0E-13
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 13 160 4.0E-13
sp|Q9LTB8|CNBL9_ARATH Calcineurin B-like protein 9 OS=Arabidopsis thaliana GN=CBL9 PE=1 SV=3 12 160 4.0E-13
sp|Q8WN03|KCIP2_MUSPF Kv channel-interacting protein 2 OS=Mustela putorius furo GN=Kcnip2 PE=2 SV=1 9 156 4.0E-13
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 1 156 5.0E-13
sp|Q7XC27|CNBL1_ORYSJ Calcineurin B-like protein 1 OS=Oryza sativa subsp. japonica GN=CBL1 PE=2 SV=2 16 160 5.0E-13
sp|Q9NZI2|KCIP1_HUMAN Kv channel-interacting protein 1 OS=Homo sapiens GN=KCNIP1 PE=1 SV=2 9 156 5.0E-13
sp|Q9QXT8|CSEN_MOUSE Calsenilin OS=Mus musculus GN=Kcnip3 PE=1 SV=2 9 156 5.0E-13
sp|Q5ZCK5|CML16_ORYSJ Probable calcium-binding protein CML16 OS=Oryza sativa subsp. japonica GN=CML16 PE=2 SV=1 22 160 5.0E-13
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 21 160 5.0E-13
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 13 171 5.0E-13
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 9 161 6.0E-13
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 9 161 7.0E-13
sp|O81445|CNBL1_ARATH Calcineurin B-like protein 1 OS=Arabidopsis thaliana GN=CBL1 PE=1 SV=3 12 151 8.0E-13
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 18 159 8.0E-13
sp|Q9JJ69|KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus GN=Kcnip2 PE=1 SV=2 9 156 8.0E-13
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 21 165 9.0E-13
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 24 163 9.0E-13
sp|Q9JM59|KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus GN=Kcnip2 PE=1 SV=2 9 156 1.0E-12
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 17 160 1.0E-12
sp|Q54LX0|CBPM_DICDI Calcium-binding protein M OS=Dictyostelium discoideum GN=cbpM PE=1 SV=1 1 156 1.0E-12
sp|Q9JJ57|KCIP1_MOUSE Kv channel-interacting protein 1 OS=Mus musculus GN=Kcnip1 PE=1 SV=2 9 156 2.0E-12
sp|Q8R426|KCIP1_RAT Kv channel-interacting protein 1 OS=Rattus norvegicus GN=Kcnip1 PE=1 SV=2 9 156 2.0E-12
sp|C7A278|CIB4_SHEEP Calcium and integrin-binding family member 4 OS=Ovis aries GN=CIB4 PE=2 SV=1 20 165 2.0E-12
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 17 160 2.0E-12
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 15 165 2.0E-12
sp|P43081|GUC1A_MOUSE Guanylyl cyclase-activating protein 1 OS=Mus musculus GN=Guca1a PE=2 SV=3 9 161 2.0E-12
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 1 156 2.0E-12
sp|P25070|CML24_ARATH Calcium-binding protein CML24 OS=Arabidopsis thaliana GN=CML24 PE=2 SV=2 26 160 2.0E-12
sp|A0AVX7|CHP3_CHICK Calcineurin B homologous protein 3 OS=Gallus gallus GN=TESC PE=2 SV=1 12 171 3.0E-12
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 17 165 3.0E-12
sp|Q9LF55|CML32_ARATH Probable calcium-binding protein CML32 OS=Arabidopsis thaliana GN=CML32 PE=2 SV=1 30 164 4.0E-12
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 21 165 4.0E-12
sp|P46065|GUC1A_BOVIN Guanylyl cyclase-activating protein 1 OS=Bos taurus GN=GUCA1A PE=1 SV=2 9 161 4.0E-12
sp|Q7L5N7|PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens GN=LPCAT2 PE=1 SV=1 39 157 4.0E-12
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 21 160 5.0E-12
sp|P43080|GUC1A_HUMAN Guanylyl cyclase-activating protein 1 OS=Homo sapiens GN=GUCA1A PE=1 SV=3 9 161 6.0E-12
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 22 160 7.0E-12
sp|P21457|RECO_BOVIN Recoverin OS=Bos taurus GN=RCVRN PE=1 SV=3 1 119 7.0E-12
sp|Q9VQH2|DUOX_DROME Dual oxidase OS=Drosophila melanogaster GN=Duox PE=1 SV=2 40 161 7.0E-12
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 20 163 8.0E-12
sp|Q8MIH6|RECO_CANLF Recoverin OS=Canis lupus familiaris GN=RCVRN PE=3 SV=1 1 128 8.0E-12
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 21 165 8.0E-12
sp|Q8BYI6|PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus GN=Lpcat2 PE=1 SV=1 39 157 1.0E-11
sp|Q9SJN6|CML31_ARATH Probable calcium-binding protein CML31 OS=Arabidopsis thaliana GN=CML31 PE=2 SV=2 30 162 1.0E-11
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 13 161 1.0E-11
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 1 160 1.0E-11
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 60 160 2.0E-11
sp|P30187|CML10_ARATH Calmodulin-like protein 10 OS=Arabidopsis thaliana GN=CML10 PE=2 SV=1 15 160 2.0E-11
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 21 165 2.0E-11
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 21 165 3.0E-11
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 21 165 4.0E-11
sp|P34057|RECO_MOUSE Recoverin OS=Mus musculus GN=Rcvrn PE=2 SV=2 1 137 4.0E-11
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 60 160 6.0E-11
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 24 165 7.0E-11
sp|P51177|GUC1B_BOVIN Guanylyl cyclase-activating protein 2 OS=Bos taurus GN=GUCA1B PE=1 SV=2 19 156 8.0E-11
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 13 162 9.0E-11
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 21 160 9.0E-11
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 21 160 9.0E-11
sp|Q1HAQ0|PCAT1_RAT Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus GN=Lpcat1 PE=2 SV=2 12 161 9.0E-11
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 24 163 1.0E-10
sp|Q96BS2|CHP3_HUMAN Calcineurin B homologous protein 3 OS=Homo sapiens GN=TESC PE=1 SV=3 2 171 1.0E-10
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 6 161 1.0E-10
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 24 165 1.0E-10
sp|Q9NRD8|DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens GN=DUOX2 PE=1 SV=2 41 170 1.0E-10
sp|Q8NF37|PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens GN=LPCAT1 PE=1 SV=2 12 161 1.0E-10
sp|Q8HZK2|DUOX2_PIG Dual oxidase 2 OS=Sus scrofa GN=DUOX2 PE=1 SV=2 41 170 1.0E-10
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 18 160 1.0E-10
sp|P0C1Q3|PCAT2_RAT Lysophosphatidylcholine acyltransferase 2 OS=Rattus norvegicus GN=Lpcat2 PE=3 SV=1 60 157 2.0E-10
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 13 164 2.0E-10
sp|Q3TFD2|PCAT1_MOUSE Lysophosphatidylcholine acyltransferase 1 OS=Mus musculus GN=Lpcat1 PE=1 SV=1 12 161 2.0E-10
sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 41 170 3.0E-10
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 15 160 3.0E-10
sp|Q9JKL5|CHP3_MOUSE Calcineurin B homologous protein 3 OS=Mus musculus GN=Tesc PE=1 SV=2 2 171 3.0E-10
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 26 163 3.0E-10
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 24 165 3.0E-10
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 13 162 4.0E-10
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 20 160 4.0E-10
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 18 160 4.0E-10
sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 41 170 4.0E-10
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 20 160 4.0E-10
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 21 156 5.0E-10
sp|P31227|SMOD_LITCT S-modulin OS=Lithobates catesbeiana PE=1 SV=4 1 131 5.0E-10
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 16 161 5.0E-10
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 15 173 6.0E-10
sp|Q4V8A1|PCT2B_RAT Lysophosphatidylcholine acyltransferase 2B OS=Rattus norvegicus GN=Lpcat2b PE=2 SV=1 39 124 6.0E-10
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 18 160 6.0E-10
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 21 156 7.0E-10
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 16 160 7.0E-10
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 17 160 7.0E-10
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 21 156 7.0E-10
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 21 156 8.0E-10
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 20 160 8.0E-10
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 13 162 8.0E-10
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 16 161 9.0E-10
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 20 161 9.0E-10
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 16 161 9.0E-10
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 18 161 1.0E-09
sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 41 170 1.0E-09
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 21 160 1.0E-09
sp|Q5ZD81|CML12_ORYSJ Probable calcium-binding protein CML12 OS=Oryza sativa subsp. japonica GN=CML12 PE=2 SV=1 21 165 1.0E-09
sp|Q9MZF4|DUOX1_CANLF Dual oxidase 1 OS=Canis lupus familiaris GN=DUOX1 PE=1 SV=1 41 170 1.0E-09
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 21 156 1.0E-09
sp|P35243|RECO_HUMAN Recoverin OS=Homo sapiens GN=RCVRN PE=1 SV=2 1 128 1.0E-09
sp|Q8VBV8|GUC1B_MOUSE Guanylyl cyclase-activating protein 2 OS=Mus musculus GN=Guca1b PE=2 SV=3 19 156 1.0E-09
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 12 161 1.0E-09
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 13 164 1.0E-09
sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 9 160 2.0E-09
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 13 162 2.0E-09
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 6 161 2.0E-09
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 17 168 2.0E-09
sp|P36609|NCS2_CAEEL Neuronal calcium sensor 2 OS=Caenorhabditis elegans GN=ncs-2 PE=2 SV=2 9 156 2.0E-09
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 3 160 3.0E-09
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 15 160 3.0E-09
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 13 164 3.0E-09
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 24 165 3.0E-09
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 16 161 4.0E-09
sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 6 170 4.0E-09
sp|Q9SU00|CML2_ARATH Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1 19 160 4.0E-09
sp|P48593|E631_DROME Calcium-binding protein E63-1 OS=Drosophila melanogaster GN=Eip63F-1 PE=2 SV=2 13 160 4.0E-09
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 21 160 4.0E-09
sp|P22728|VISI_CHICK Visinin OS=Gallus gallus PE=2 SV=5 1 147 4.0E-09
sp|Q9D5U0|PCT2B_MOUSE Lysophosphatidylcholine acyltransferase 2B OS=Mus musculus GN=Lpcat2b PE=2 SV=1 44 124 5.0E-09
sp|O73763|GCIP_LITPI Guanylyl cyclase inhibitory protein OS=Lithobates pipiens GN=GCIP PE=2 SV=3 53 156 5.0E-09
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 21 160 5.0E-09
sp|P79881|GUC1B_CHICK Guanylyl cyclase-activating protein 2 OS=Gallus gallus GN=GUCA1B PE=2 SV=3 16 156 5.0E-09
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 15 160 7.0E-09
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 13 162 8.0E-09
sp|Q9SUA6|CNBL7_ARATH Calcineurin B-like protein 7 OS=Arabidopsis thaliana GN=CBL7 PE=1 SV=1 57 160 8.0E-09
sp|Q9SRP4|CML33_ARATH Probable calcium-binding protein CML33 OS=Arabidopsis thaliana GN=CML33 PE=2 SV=1 30 153 8.0E-09
sp|Q9UMX6|GUC1B_HUMAN Guanylyl cyclase-activating protein 2 OS=Homo sapiens GN=GUCA1B PE=1 SV=4 19 156 1.0E-08
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 26 156 1.0E-08
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 13 161 1.0E-08
sp|Q86IV8|CBPKL_DICDI Calcium-binding protein K-like OS=Dictyostelium discoideum GN=DDB_G0274357 PE=3 SV=1 1 115 1.0E-08
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 20 168 2.0E-08
sp|Q3SB13|CALGL_PSETE Calglandulin OS=Pseudonaja textilis PE=2 SV=1 15 160 2.0E-08
sp|Q3SB08|CALGL_PSEPO Calglandulin OS=Pseudechis porphyriacus PE=2 SV=1 15 160 2.0E-08
sp|Q3SB09|CALGL_PSEAU Calglandulin OS=Pseudechis australis PE=2 SV=1 15 160 2.0E-08
sp|Q3SB15|CALGL_OXYSC Calglandulin OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 15 160 2.0E-08
sp|Q3SB14|CALGL_OXYMI Calglandulin OS=Oxyuranus microlepidotus PE=2 SV=1 15 160 2.0E-08
sp|Q3SB12|CALGL_NOTSC Calglandulin OS=Notechis scutatus scutatus PE=2 SV=1 15 160 2.0E-08
sp|Q3SB10|CALGL_HOPST Calglandulin OS=Hoplocephalus stephensii PE=2 SV=1 15 160 2.0E-08
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 24 156 2.0E-08
sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 21 160 2.0E-08
sp|Q11083|YT67_CAEEL Uncharacterized calcium-binding protein B0563.7 OS=Caenorhabditis elegans GN=B0563.7 PE=3 SV=1 18 161 2.0E-08
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 13 161 2.0E-08
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 18 165 2.0E-08
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 21 162 2.0E-08
sp|O73762|GUC1B_LITPI Guanylyl cyclase-activating protein 2 OS=Lithobates pipiens GN=GUCA1B PE=2 SV=3 19 156 2.0E-08
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 20 160 2.0E-08
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 13 160 3.0E-08
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 26 166 3.0E-08
sp|P04109|SPE1A_STRPU Calcium-binding protein SPEC 1A OS=Strongylocentrotus purpuratus GN=SPEC1 PE=2 SV=3 18 163 3.0E-08
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 20 166 3.0E-08
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 13 160 4.0E-08
sp|Q0DJ94|CML21_ORYSJ Probable calcium-binding protein CML21 OS=Oryza sativa subsp. japonica GN=CML21 PE=2 SV=2 14 162 4.0E-08
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 90 160 5.0E-08
sp|Q8VHC5|CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus GN=Cabp4 PE=1 SV=1 70 162 5.0E-08
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 13 162 6.0E-08
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 13 161 8.0E-08
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 21 165 8.0E-08
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 13 163 9.0E-08
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 18 163 1.0E-07
sp|P04110|SPE2A_STRPU Calcium-binding protein SPEC 2A OS=Strongylocentrotus purpuratus GN=SPEC2A PE=2 SV=2 18 163 1.0E-07
sp|P57796|CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens GN=CABP4 PE=1 SV=2 70 160 1.0E-07
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 13 162 1.0E-07
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 13 162 1.0E-07
sp|Q6DN52|CBPL_DICDI Calcium-binding protein L OS=Dictyostelium discoideum GN=cbpL PE=2 SV=1 1 169 1.0E-07
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 22 160 1.0E-07
sp|Q9SS31|CML36_ARATH Probable calcium-binding protein CML36 OS=Arabidopsis thaliana GN=CML36 PE=2 SV=1 4 161 1.0E-07
sp|Q8NFA0|UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens GN=USP32 PE=1 SV=1 16 157 2.0E-07
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 21 161 2.0E-07
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 13 162 2.0E-07
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 13 160 2.0E-07
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 19 165 2.0E-07
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 13 161 2.0E-07
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 26 161 2.0E-07
sp|Q0DZP5|CML17_ORYSJ Probable calcium-binding protein CML17 OS=Oryza sativa subsp. japonica GN=CML17 PE=2 SV=1 26 160 3.0E-07
sp|P21797|TNNC1_BALNU Troponin C, isoform 1 OS=Balanus nubilus PE=1 SV=1 16 160 3.0E-07
sp|Q8HZJ4|CABP4_BOVIN Calcium-binding protein 4 OS=Bos taurus GN=CABP4 PE=2 SV=1 21 160 5.0E-07
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 13 169 5.0E-07
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 21 162 6.0E-07
sp|P06707|TNNC1_ASTLP Troponin C, isotype alpha OS=Astacus leptodactylus PE=1 SV=1 17 120 7.0E-07
sp|Q8VZ50|CML14_ARATH Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1 21 156 7.0E-07
sp|Q9LPK5|CML44_ARATH Probable calcium-binding protein CML44 OS=Arabidopsis thaliana GN=CML44 PE=2 SV=2 26 160 1.0E-06
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 16 160 1.0E-06
sp|Q94AZ4|CML13_ARATH Probable calcium-binding protein CML13 OS=Arabidopsis thaliana GN=CML13 PE=2 SV=1 21 156 1.0E-06
sp|Q86JE1|Y2130_DICDI Recoverin family protein DDB_G0272130 OS=Dictyostelium discoideum GN=DDB_G0272130 PE=1 SV=1 1 163 1.0E-06
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 52 156 1.0E-06
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 52 156 1.0E-06
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 13 165 2.0E-06
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 52 156 2.0E-06
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 52 156 2.0E-06
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 52 156 2.0E-06
sp|P21798|TNNC2_BALNU Troponin C, isoform 2 OS=Balanus nubilus PE=1 SV=2 18 160 2.0E-06
sp|Q9SVG9|CML42_ARATH Calcium-binding protein CML42 OS=Arabidopsis thaliana GN=CML42 PE=1 SV=1 86 168 3.0E-06
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 26 161 3.0E-06
sp|Q9C9U8|CML26_ARATH Probable calcium-binding protein CML26 OS=Arabidopsis thaliana GN=CML26 PE=1 SV=1 26 165 3.0E-06
sp|Q9SRR7|CML3_ARATH Calmodulin-like protein 3 OS=Arabidopsis thaliana GN=CML3 PE=2 SV=1 19 161 3.0E-06
sp|Q6Z2J1|CML20_ORYSJ Probable calcium-binding protein CML20 OS=Oryza sativa subsp. japonica GN=CML20 PE=2 SV=1 8 160 4.0E-06
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 13 156 4.0E-06
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 52 156 4.0E-06
sp|Q39584|DYL3_CHLRE Dynein 18 kDa light chain, flagellar outer arm OS=Chlamydomonas reinhardtii PE=1 SV=1 17 160 4.0E-06
sp|Q84VG0|CML7_ORYSJ Probable calcium-binding protein CML7 OS=Oryza sativa subsp. japonica GN=CML7 PE=2 SV=1 15 160 4.0E-06
sp|Q8TD86|CALL6_HUMAN Calmodulin-like protein 6 OS=Homo sapiens GN=CALML6 PE=2 SV=2 21 160 5.0E-06
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 26 160 6.0E-06
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 13 166 6.0E-06
sp|Q7XHW4|CML24_ORYSJ Probable calcium-binding protein CML24 OS=Oryza sativa subsp. japonica GN=CML24 PE=2 SV=1 25 165 8.0E-06
sp|P34368|YLJ5_CAEEL Uncharacterized calcium-binding protein C50C3.5 OS=Caenorhabditis elegans GN=C50C3.5 PE=3 SV=3 9 162 9.0E-06
sp|Q84UL5|CML32_ORYSJ Probable calcium-binding protein CML32 OS=Oryza sativa subsp. japonica GN=CML32 PE=2 SV=1 95 165 9.0E-06
sp|Q8RYJ8|CML19_ORYSJ Putative calcium-binding protein CML19 OS=Oryza sativa subsp. japonica GN=CML19 PE=3 SV=1 26 162 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2826
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1713 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7359
Ophiocordyceps camponoti-floridani Ophcf2|04818
Ophiocordyceps camponoti-rufipedis Ophun1|6188
Ophiocordyceps kimflemingae Ophio5|2828
Ophiocordyceps subramaniannii Hirsu2|458

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1713
MGNTTSQILDNIVQGSNFDREEVERLRKRFMKLDKDNSGTIERDEFLSLPQISSNPLATRMIAIFDEDGGGDVDF
QEFVSGLSAFSSKGNKDQKLRFAFKVYDIDRDGYISNGELFIVLKMMVGSNLKDQQLQQIVDKTIMEADLDKDGK
ISFEEFKKMVETTDISMSMTLDQI*
Coding >OphauG2|1713
ATGGGGAACACAACGAGCCAGATCCTCGATAACATCGTCCAGGGGTCCAACTTCGACAGGGAGGAGGTAGAGCGG
CTGCGGAAACGCTTCATGAAGTTGGATAAGGACAACTCTGGAACTATAGAGCGCGATGAGTTTTTAAGCTTGCCA
CAGATTTCATCGAATCCGCTAGCAACACGTATGATTGCCATATTTGACGAGGACGGCGGCGGTGATGTCGATTTT
CAAGAATTCGTCTCTGGCCTGAGTGCCTTTAGCAGCAAGGGCAACAAGGATCAGAAGCTACGCTTTGCGTTCAAA
GTGTACGACATTGACCGTGACGGCTACATCAGCAACGGCGAGCTCTTTATTGTCCTCAAGATGATGGTGGGCAGC
AACTTGAAGGACCAGCAACTGCAGCAGATTGTCGACAAGACAATCATGGAGGCGGACTTGGACAAGGATGGCAAG
ATCAGCTTCGAGGAATTCAAGAAGATGGTGGAGACAACGGATATCAGCATGAGCATGACTTTGGATCAAATTTGA
Transcript >OphauG2|1713
ATGGGGAACACAACGAGCCAGATCCTCGATAACATCGTCCAGGGGTCCAACTTCGACAGGGAGGAGGTAGAGCGG
CTGCGGAAACGCTTCATGAAGTTGGATAAGGACAACTCTGGAACTATAGAGCGCGATGAGTTTTTAAGCTTGCCA
CAGATTTCATCGAATCCGCTAGCAACACGTATGATTGCCATATTTGACGAGGACGGCGGCGGTGATGTCGATTTT
CAAGAATTCGTCTCTGGCCTGAGTGCCTTTAGCAGCAAGGGCAACAAGGATCAGAAGCTACGCTTTGCGTTCAAA
GTGTACGACATTGACCGTGACGGCTACATCAGCAACGGCGAGCTCTTTATTGTCCTCAAGATGATGGTGGGCAGC
AACTTGAAGGACCAGCAACTGCAGCAGATTGTCGACAAGACAATCATGGAGGCGGACTTGGACAAGGATGGCAAG
ATCAGCTTCGAGGAATTCAAGAAGATGGTGGAGACAACGGATATCAGCATGAGCATGACTTTGGATCAAATTTGA
Gene >OphauG2|1713
ATGGGGAACACAACGAGCCAGATCCTCGATAACATCGTCCAGGGGTCCAACTGTGAGCTACTGGTGCGCGCGTAG
CGGTAGAGAGATTGCAGAGGGGGATGCGCTAACGAGCTGTACAGTCGACAGGGAGGAGGTAGAGCGGCTGCGGAA
ACGCTTCATGAAGTTGGATAAGGTGCCAAGTGCTTTCCCATCAGACCAAAAAGAAGTCTCATCCCACGGCTGACG
GTCATATGCATACTATTAGGACAACTCTGGAACTATAGAGCGCGATGAGTTTTTAAGCTTGCCACAGATTTCATC
GAATCCGCTAGCAACACGGTACTCCTCTTTTCTTCCCCGCGATATGCACCGTCAGACAAAATACCGCGATACTGA
CTCGAGCGACTCATTGCAGTATGATTGCCATATTTGACGAGGACGGCGGCGGTGATGTCGATTTTCAAGAATTCG
TCTCTGGCCTGAGTGCCTTTAGCAGCAAGGGCAACAAGGATCAGAAGCTACGCTTTGCGTTCAAAGTGTACGACA
TTGACCGTGACGGCTACATCAGCAACGGCGAGCTCTTTATTGTCCTCAAGATGATGGTGGGCAGCAACTTGAAGG
ACCAGCAACTGCAGCAGATTGTCGACAAGACAATCATGGAGGCGGACTTGGACAAGGATGGCAAGATCAGCTTCG
AGGAATTCAAGAAGATGGTGGAGACAACGGATATCAGCATGAGCATGACTTTGGGTAAGTGTTGTGGTTTTGTTT
CTTGGTGCTGTGAGAGTGTGTATTGATGACTGTCTGGACAGATCAAATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail