Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1710
Gene name
LocationContig_154:5060..6554
Strand+
Gene length (bp)1494
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain 1.7E-25 379 448
PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase 1.4E-24 220 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04739|GAL83_YEAST SNF1 protein kinase subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL83 PE=1 SV=1 219 448 8.0E-35
sp|P34164|SIP2_YEAST SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIP2 PE=1 SV=3 215 448 2.0E-32
sp|P78789|YC63_SCHPO Uncharacterized protein C1919.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1919.03c PE=1 SV=2 218 447 2.0E-31
sp|O43741|AAKB2_HUMAN 5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens GN=PRKAB2 PE=1 SV=1 206 448 1.0E-19
sp|Q9Y478|AAKB1_HUMAN 5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens GN=PRKAB1 PE=1 SV=4 221 448 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04739|GAL83_YEAST SNF1 protein kinase subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL83 PE=1 SV=1 219 448 8.0E-35
sp|P34164|SIP2_YEAST SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIP2 PE=1 SV=3 215 448 2.0E-32
sp|P78789|YC63_SCHPO Uncharacterized protein C1919.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1919.03c PE=1 SV=2 218 447 2.0E-31
sp|O43741|AAKB2_HUMAN 5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens GN=PRKAB2 PE=1 SV=1 206 448 1.0E-19
sp|Q9Y478|AAKB1_HUMAN 5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens GN=PRKAB1 PE=1 SV=4 221 448 3.0E-19
sp|Q5R801|AAKB1_PONAB 5'-AMP-activated protein kinase subunit beta-1 OS=Pongo abelii GN=PRKAB1 PE=2 SV=3 221 448 4.0E-19
sp|Q6PAM0|AAKB2_MOUSE 5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus GN=Prkab2 PE=1 SV=1 221 448 5.0E-19
sp|Q9R078|AAKB1_MOUSE 5'-AMP-activated protein kinase subunit beta-1 OS=Mus musculus GN=Prkab1 PE=1 SV=2 221 448 3.0E-18
sp|Q9QZH4|AAKB2_RAT 5'-AMP-activated protein kinase subunit beta-2 OS=Rattus norvegicus GN=Prkab2 PE=1 SV=1 213 448 3.0E-18
sp|P80386|AAKB1_RAT 5'-AMP-activated protein kinase subunit beta-1 OS=Rattus norvegicus GN=Prkab1 PE=1 SV=4 221 448 4.0E-18
sp|Q5BIS9|AAKB1_BOVIN 5'-AMP-activated protein kinase subunit beta-1 OS=Bos taurus GN=PRKAB1 PE=2 SV=3 221 448 5.0E-18
sp|Q9SCY5|KINB2_ARATH SNF1-related protein kinase regulatory subunit beta-2 OS=Arabidopsis thaliana GN=KINB2 PE=1 SV=1 220 447 1.0E-13
sp|Q944A6|SNF4_ARATH Sucrose nonfermenting 4-like protein OS=Arabidopsis thaliana GN=SNF4 PE=1 SV=1 219 307 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1710
MGNNHSSASKSASALSPPSTAAPHSVQQTHQHASRRDARNILPVHSTQRSAAPPEASLAQAHGSTSVNRPKSLPS
TAVSSLSASPLSNVSTPTKPADSRQALRHEPSKPVDVPLESSSLRSHAIYPHHPVHSHHLPTDHTVSNSSLTDMY
LRGPPRLPLPIEEEVHTPGSPILAPDDGFGQIDLGDSSDGLTRKSSGVSANTLDDEESEELRVDKTRPLVPVRLE
WNHGGEKVYVTGTIFQWNRKHRLHPVQGKPRCLAATIHILPGTHHIRFLVDGIMQTSPDLPTTVDFGNNLVNYIE
VSPDDVPKQRQGSQSKSEGEGEGVSRTSSQAKDQPRPPKGKPVEPPERYCCEVPQYLLDFDQPEESTAYRNAVGA
IEKLPTPPSLPGFLAKPILNAATLMKDDNSVLNMPNHTVLNHLATSSIKNNILAVSATTRYRNKYVTTIMYKPAS
ADEG*
Coding >OphauG2|1710
ATGGGCAACAACCACTCATCGGCTTCCAAGTCGGCTTCGGCCCTCTCGCCGCCCTCGACTGCCGCCCCGCACTCT
GTCCAACAGACTCACCAACACGCCAGCCGCAGAGACGCCCGCAACATCCTGCCCGTTCATTCCACCCAGCGCTCT
GCTGCTCCGCCAGAGGCCTCGTTGGCCCAGGCCCACGGCTCCACCTCGGTAAACCGCCCCAAGAGCCTGCCCAGC
ACTGCTGTGTCGTCGCTCAGCGCATCGCCCCTTAGCAACGTGTCGACGCCCACCAAGCCTGCAGACAGCCGCCAA
GCACTCCGCCACGAGCCCTCCAAGCCCGTCGACGTGCCCCTTGAATCGTCGTCGCTGCGCTCCCACGCCATCTAT
CCCCACCACCCCGTACACTCTCATCATCTCCCAACCGACCACACCGTCTCCAACAGCAGCCTCACCGACATGTAT
CTGCGCGGGCCTCCACGCCTTCCACTGCCAATAGAGGAGGAAGTACACACCCCTGGATCCCCCATACTCGCCCCC
GACGATGGCTTTGGCCAAATCGACCTGGGCGACTCCTCGGACGGCCTGACACGCAAGAGCTCGGGCGTGAGCGCA
AACACTCTCGACGACGAGGAATCTGAGGAGCTACGTGTCGATAAGACCCGGCCCTTGGTCCCCGTGCGACTTGAA
TGGAACCATGGCGGCGAAAAGGTTTACGTTACTGGAACTATTTTCCAGTGGAATCGCAAGCACAGGCTCCACCCA
GTCCAAGGCAAACCCAGGTGTCTGGCCGCCACGATACACATTCTGCCAGGCACTCACCACATTCGATTCCTCGTT
GATGGCATTATGCAGACGTCGCCGGATCTGCCCACGACGGTTGACTTTGGCAACAACCTGGTCAACTACATCGAG
GTTAGTCCCGACGATGTGCCCAAGCAGAGGCAAGGCAGCCAGTCCAAATCCGAGGGCGAGGGCGAAGGCGTTTCA
CGGACCAGCTCGCAAGCCAAGGACCAGCCTCGACCTCCCAAGGGCAAGCCTGTCGAGCCTCCCGAGCGATACTGC
TGCGAAGTGCCGCAATATCTGCTCGACTTTGACCAGCCCGAGGAATCAACGGCATACCGCAATGCTGTTGGGGCC
ATTGAGAAGCTGCCGACGCCACCCAGTTTGCCGGGCTTTTTGGCCAAGCCCATTCTCAATGCAGCGACGCTCATG
AAGGACGATAATAGCGTGCTCAACATGCCCAACCACACTGTGCTCAACCACTTGGCGACGAGCAGCATTAAGAAT
AACATTCTTGCCGTCTCGGCCACGACGAGATATCGCAACAAGTACGTGACTACAATCATGTATAAGCCAGCATCC
GCAGACGAGGGCTGA
Transcript >OphauG2|1710
ATGGGCAACAACCACTCATCGGCTTCCAAGTCGGCTTCGGCCCTCTCGCCGCCCTCGACTGCCGCCCCGCACTCT
GTCCAACAGACTCACCAACACGCCAGCCGCAGAGACGCCCGCAACATCCTGCCCGTTCATTCCACCCAGCGCTCT
GCTGCTCCGCCAGAGGCCTCGTTGGCCCAGGCCCACGGCTCCACCTCGGTAAACCGCCCCAAGAGCCTGCCCAGC
ACTGCTGTGTCGTCGCTCAGCGCATCGCCCCTTAGCAACGTGTCGACGCCCACCAAGCCTGCAGACAGCCGCCAA
GCACTCCGCCACGAGCCCTCCAAGCCCGTCGACGTGCCCCTTGAATCGTCGTCGCTGCGCTCCCACGCCATCTAT
CCCCACCACCCCGTACACTCTCATCATCTCCCAACCGACCACACCGTCTCCAACAGCAGCCTCACCGACATGTAT
CTGCGCGGGCCTCCACGCCTTCCACTGCCAATAGAGGAGGAAGTACACACCCCTGGATCCCCCATACTCGCCCCC
GACGATGGCTTTGGCCAAATCGACCTGGGCGACTCCTCGGACGGCCTGACACGCAAGAGCTCGGGCGTGAGCGCA
AACACTCTCGACGACGAGGAATCTGAGGAGCTACGTGTCGATAAGACCCGGCCCTTGGTCCCCGTGCGACTTGAA
TGGAACCATGGCGGCGAAAAGGTTTACGTTACTGGAACTATTTTCCAGTGGAATCGCAAGCACAGGCTCCACCCA
GTCCAAGGCAAACCCAGGTGTCTGGCCGCCACGATACACATTCTGCCAGGCACTCACCACATTCGATTCCTCGTT
GATGGCATTATGCAGACGTCGCCGGATCTGCCCACGACGGTTGACTTTGGCAACAACCTGGTCAACTACATCGAG
GTTAGTCCCGACGATGTGCCCAAGCAGAGGCAAGGCAGCCAGTCCAAATCCGAGGGCGAGGGCGAAGGCGTTTCA
CGGACCAGCTCGCAAGCCAAGGACCAGCCTCGACCTCCCAAGGGCAAGCCTGTCGAGCCTCCCGAGCGATACTGC
TGCGAAGTGCCGCAATATCTGCTCGACTTTGACCAGCCCGAGGAATCAACGGCATACCGCAATGCTGTTGGGGCC
ATTGAGAAGCTGCCGACGCCACCCAGTTTGCCGGGCTTTTTGGCCAAGCCCATTCTCAATGCAGCGACGCTCATG
AAGGACGATAATAGCGTGCTCAACATGCCCAACCACACTGTGCTCAACCACTTGGCGACGAGCAGCATTAAGAAT
AACATTCTTGCCGTCTCGGCCACGACGAGATATCGCAACAAGTACGTGACTACAATCATGTATAAGCCAGCATCC
GCAGACGAGGGCTGA
Gene >OphauG2|1710
ATGGGCAACAACCACTCATCGGCTTCCAAGTCGGCTTCGGCCCTCTCGCCGCCCTCGACTGCCGCCCCGCACTCT
GTCCAACAGACTCACCAACACGCCAGCCGCAGAGACGCCCGCAACATCCTGCCCGTTCATTCCACCCAGCGCTCT
GCTGCTCCGCCAGAGGCCTCGTTGGCCCAGGCCCACGGCTCCACCTCGGTAAACCGCCCCAAGAGCCTGCCCAGC
ACTGCTGTGTCGTCGCTCAGCGCATCGCCCCTTAGCAACGTGTCGACGCCCACCAAGCCTGCAGACAGCCGCCAA
GCACTCCGCCACGAGCCCTCCAAGCCCGTCGACGTGCCCCTTGAATCGTCGTCGCTGCGCTCCCACGCCATCTAT
CCCCACCACCCCGTACACTCTCATCATCTCCCAACCGACCACACCGTCTCCAACAGCAGCCTCACCGACATGTAT
CTGCGCGGGCCTCCACGCCTTCCACTGCCAATAGAGGAGGAAGTACACACCCCTGGATCCCCCATACTCGCCCCC
GACGATGGCTTTGGCCAAATCGACCTGGGCGACTCCTCGGACGGCCTGACACGCAAGAGCTCGGGCGTGAGCGCA
AACACTCTCGACGACGAGGAATCTGAGGAGCTACGTGTCGATAAGACCCGGCCCTTGGTCCCCGTGCGACTTGAA
TGGAACCATGGCGGCGAAAAGGTTTACGTTACTGGAACTATTTTCCAGTGGAATCGCAAGCACAGGCTCCACCCA
GTGTAAGTGCCTAATCGTCACGTCTGCCCTGAGCCATGTCTGACTCGGCCTTGTAGCCAAGGCAAACCCAGGTGT
CTGGCCGCCACGATACACATTCTGCCAGGCACTCACCACATTCGATTCCTCGTTGATGGCATTATGCAGACGTCG
CCGGATCTGCCCACGACGGTTGACTTTGGCAACAACCTGGTCAACTACATCGAGGTTAGTCCCGACGATGTGCCC
AAGCAGAGGCAAGGCAGCCAGTCCAAATCCGAGGGCGAGGGCGAAGGCGTTTCACGGACCAGCTCGCAAGCCAAG
GACCAGCCTCGACCTCCCAAGGGCAAGCCTGTCGAGCCTCCCGAGCGATACTGCTGCGAAGTGCCGCAATATCTG
CTCGACTTTGACCAGCCCGAGGAATCAACGGCATACCGCAATGCTGTTGGGGCCATTGAGAAGCTGCCGACGCCA
CCCAGTTTGCCGGGCTTTTTGGCCAAGCCCATTCTCAATGCAGCGACGCTCATGAAGGACGATAATAGCGTGCTC
AACATGCCCAACCACACTGTGCTCAACCACTTGGCGACGAGCAGCATTAAGAATAACATTCTTGCCGTCTCGGCC
ACGACGAGATATCGCAACAAGGTGAGGCTACTTTTAACACCCCCCCACCCCCGCAAGACTGTGGATCAATGCTTA
TACTCTAATTTGCATATGCAGTACGTGACTACAATCATGTATAAGCCAGCATCCGCAGACGAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail