Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1690
Gene name
LocationContig_153:6570..7161
Strand-
Gene length (bp)591
Transcript length (bp)378
Coding sequence length (bp)378
Protein length (aa) 126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP 4.3E-42 10 124

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37552|RIDA_BACSU 2-iminobutanoate/2-iminopropanoate deaminase OS=Bacillus subtilis (strain 168) GN=yabJ PE=1 SV=3 7 124 8.0E-42
sp|O58584|Y854_PYRHO RutC family protein PH0854 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0854 PE=1 SV=2 4 123 3.0E-39
sp|Q9UZA3|Y1251_PYRAB RutC family protein PYRAB12510 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB12510 PE=3 SV=1 4 123 8.0E-39
sp|Q8U308|RIDA_PYRFU 2-iminobutanoate/2-iminopropanoate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=yjgF PE=1 SV=1 4 123 1.0E-38
sp|P40185|MMF1_YEAST Protein MMF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMF1 PE=1 SV=1 5 124 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37552|RIDA_BACSU 2-iminobutanoate/2-iminopropanoate deaminase OS=Bacillus subtilis (strain 168) GN=yabJ PE=1 SV=3 7 124 8.0E-42
sp|O58584|Y854_PYRHO RutC family protein PH0854 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0854 PE=1 SV=2 4 123 3.0E-39
sp|Q9UZA3|Y1251_PYRAB RutC family protein PYRAB12510 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB12510 PE=3 SV=1 4 123 8.0E-39
sp|Q8U308|RIDA_PYRFU 2-iminobutanoate/2-iminopropanoate deaminase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=yjgF PE=1 SV=1 4 123 1.0E-38
sp|P40185|MMF1_YEAST Protein MMF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMF1 PE=1 SV=1 5 124 1.0E-36
sp|O43003|MMF1_SCHPO Protein mmf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mmf1 PE=3 SV=1 17 124 4.0E-36
sp|P40037|HMF1_YEAST Protein HMF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMF1 PE=1 SV=1 23 123 5.0E-36
sp|Q973T6|Y811_SULTO RutC family protein STK_08110 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_08110 PE=1 SV=1 7 122 2.0E-30
sp|P55654|Y4SK_RHISN RutC family protein y4sK OS=Rhizobium sp. (strain NGR234) GN=NGR_a01620 PE=3 SV=1 9 122 4.0E-30
sp|O66689|Y364_AQUAE RutC family protein aq_364 OS=Aquifex aeolicus (strain VF5) GN=aq_364 PE=3 SV=1 12 124 4.0E-29
sp|Q7CP78|RIDA_SALTY 2-iminobutanoate/2-iminopropanoate deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ridA PE=1 SV=1 7 124 1.0E-28
sp|Q9L6B5|Y1466_PASMU RutC family protein PM1466 OS=Pasteurella multocida (strain Pm70) GN=PM1466 PE=3 SV=1 6 124 2.0E-28
sp|Q97U19|Y3206_SULSO RutC family protein SSO3206 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO3206 PE=3 SV=1 4 123 2.0E-28
sp|P0AF95|RIDA_SHIFL 2-iminobutanoate/2-iminopropanoate deaminase OS=Shigella flexneri GN=yjgF PE=3 SV=2 7 124 3.0E-28
sp|P0AF93|RIDA_ECOLI 2-iminobutanoate/2-iminopropanoate deaminase OS=Escherichia coli (strain K12) GN=ridA PE=1 SV=2 7 124 3.0E-28
sp|P0AF94|RIDA_ECOL6 2-iminobutanoate/2-iminopropanoate deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yjgF PE=3 SV=2 7 124 3.0E-28
sp|O34133|ALDR_LACLA Putative regulator AldR OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=aldR PE=3 SV=2 6 123 4.0E-28
sp|P52761|Y709_SYNY3 RutC family protein slr0709 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0709 PE=3 SV=1 6 124 4.0E-28
sp|P0AGL4|TDCF_SHIFL Putative reactive intermediate deaminase TdcF OS=Shigella flexneri GN=tdcF PE=3 SV=1 6 124 8.0E-28
sp|P0AGL2|TDCF_ECOLI Putative reactive intermediate deaminase TdcF OS=Escherichia coli (strain K12) GN=tdcF PE=1 SV=1 6 124 8.0E-28
sp|P0AGL3|TDCF_ECOL6 Putative reactive intermediate deaminase TdcF OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdcF PE=3 SV=1 6 124 8.0E-28
sp|P52760|UK114_MOUSE Ribonuclease UK114 OS=Mus musculus GN=Hrsp12 PE=1 SV=3 4 124 2.0E-27
sp|O52178|DFRA_MYXXA Protein DfrA OS=Myxococcus xanthus GN=dfrA PE=3 SV=1 9 124 2.0E-27
sp|P57452|Y371_BUCAI RutC family protein BU371 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU371 PE=3 SV=1 6 124 3.0E-27
sp|P44839|Y719_HAEIN RutC family protein HI_0719 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0719 PE=1 SV=1 6 124 3.0E-27
sp|P52758|UK114_HUMAN Ribonuclease UK114 OS=Homo sapiens GN=HRSP12 PE=1 SV=1 4 124 4.0E-27
sp|Q3T114|UK114_BOVIN Ribonuclease UK114 OS=Bos taurus GN=HRSP12 PE=2 SV=3 4 124 1.0E-26
sp|Q10121|YSD2_CAEEL RutC family protein C23G10.2 OS=Caenorhabditis elegans GN=C23G10.2 PE=3 SV=3 4 124 2.0E-26
sp|P80601|UK114_CAPHI Ribonuclease UK114 OS=Capra hircus GN=HRSP12 PE=1 SV=3 4 124 3.0E-26
sp|P40431|YVN1_AZOVI RutC family protein in vnfA 5'region OS=Azotobacter vinelandii PE=3 SV=2 4 122 3.0E-26
sp|P52759|UK114_RAT Ribonuclease UK114 OS=Rattus norvegicus GN=Hrsp12 PE=1 SV=3 4 124 6.0E-26
sp|Q94JQ4|RIDA_ARATH Reactive Intermediate Deaminase A, chloroplastic OS=Arabidopsis thaliana GN=RIDA PE=1 SV=1 6 123 8.0E-26
sp|Q8K9H7|Y359_BUCAP RutC family protein BUsg_359 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_359 PE=3 SV=1 6 124 1.0E-25
sp|O25598|Y944_HELPY RutC family protein HP_0944 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0944 PE=3 SV=1 6 124 3.0E-24
sp|P97117|Y142_LEUMC RutC family protein in leuC 5'region OS=Leuconostoc mesenteroides subsp. cremoris PE=3 SV=1 6 124 5.0E-24
sp|Q9ZKQ6|Y944_HELPJ RutC family protein jhp_0879 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0879 PE=3 SV=1 6 124 6.0E-24
sp|Q9UR06|MMF2_SCHPO Protein mmf2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mmf2 PE=3 SV=1 17 123 4.0E-23
sp|Q89AG0|Y334_BUCBP RutC family protein bbp_334 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_334 PE=3 SV=1 12 123 7.0E-22
sp|Q6FFZ5|RUTC_ACIAD Putative aminoacrylate peracid reductase RutC OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rutC PE=3 SV=1 4 123 2.0E-16
sp|A8IAD2|RUTC_AZOC5 Putative aminoacrylate peracid reductase RutC OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rutC PE=3 SV=1 7 123 1.0E-15
sp|B1ZB17|RUTC_METPB Putative aminoacrylate peracid reductase RutC OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rutC PE=3 SV=1 4 123 3.0E-15
sp|B1M5I6|RUTC_METRJ Putative aminoacrylate peracid reductase RutC OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rutC PE=3 SV=1 4 123 4.0E-15
sp|A9W3H9|RUTC_METEP Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain PA1) GN=rutC PE=3 SV=1 4 123 4.0E-15
sp|C7CM34|RUTC_METED Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain DSM 5838 / DM4) GN=rutC PE=3 SV=1 4 123 4.0E-15
sp|B7KWT5|RUTC_METC4 Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rutC PE=3 SV=1 4 123 4.0E-15
sp|A1JMX4|RUTC_YERE8 Putative aminoacrylate peracid reductase RutC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rutC PE=3 SV=1 1 123 1.0E-14
sp|C5B0U7|RUTC_METEA Putative aminoacrylate peracid reductase RutC OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=rutC PE=3 SV=1 4 123 1.0E-14
sp|D5VGV2|RUTC_CAUST Putative aminoacrylate peracid reductase RutC OS=Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059) GN=rutC PE=3 SV=1 4 123 3.0E-14
sp|Q9A4N4|RUTC_CAUCR Putative aminoacrylate peracid reductase RutC OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rutC PE=3 SV=1 4 123 1.0E-13
sp|B8H1Q2|RUTC_CAUCN Putative aminoacrylate peracid reductase RutC OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rutC PE=3 SV=1 4 123 1.0E-13
sp|B9JLT7|RUTC_AGRRK Putative aminoacrylate peracid reductase RutC OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rutC PE=3 SV=1 4 123 2.0E-13
sp|D3RKL2|RUTC_KLEVT Putative aminoacrylate peracid reductase RutC OS=Klebsiella variicola (strain At-22) GN=rutC PE=3 SV=1 6 123 4.0E-13
sp|B5XXN2|RUTC_KLEP3 Putative aminoacrylate peracid reductase RutC OS=Klebsiella pneumoniae (strain 342) GN=rutC PE=3 SV=1 6 123 4.0E-13
sp|A6T7A0|RUTC_KLEP7 Putative aminoacrylate peracid reductase RutC OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rutC PE=3 SV=1 6 123 2.0E-12
sp|Q7CWX2|RUTC_AGRFC Putative aminoacrylate peracid reductase RutC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rutC PE=3 SV=2 6 123 7.0E-12
sp|B0SW61|RUTC_CAUSK Putative aminoacrylate peracid reductase RutC OS=Caulobacter sp. (strain K31) GN=rutC PE=3 SV=1 4 123 9.0E-12
sp|A4VQH6|RUTC_PSEU5 Putative aminoacrylate peracid reductase RutC OS=Pseudomonas stutzeri (strain A1501) GN=rutC PE=3 SV=1 1 123 1.0E-11
sp|D4GEU6|RUTC_PANAM Putative aminoacrylate peracid reductase RutC OS=Pantoea ananatis (strain LMG 20103) GN=rutC PE=3 SV=1 7 123 2.0E-11
sp|D5CE34|RUTC_ENTCC Putative aminoacrylate peracid reductase RutC OS=Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCDC 279-56) GN=rutC PE=3 SV=1 4 123 3.0E-11
sp|C9Y0S5|RUTC_SICTZ Putative aminoacrylate peracid reductase RutC OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=rutC PE=3 SV=1 4 123 4.0E-11
sp|A8GCT4|RUTC_SERP5 Putative aminoacrylate peracid reductase RutC OS=Serratia proteamaculans (strain 568) GN=rutC PE=3 SV=1 4 123 6.0E-11
sp|A7ME54|RUTC_CROS8 Putative aminoacrylate peracid reductase RutC OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rutC PE=3 SV=1 6 123 1.0E-10
sp|D0LI57|RUTC_HALO1 Putative aminoacrylate peracid reductase RutC OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=rutC PE=3 SV=1 13 123 2.0E-10
sp|C5CN81|RUTC_VARPS Putative aminoacrylate peracid reductase RutC OS=Variovorax paradoxus (strain S110) GN=rutC PE=3 SV=1 7 123 3.0E-10
sp|Q9KWS2|AMND_PSESP 2-aminomuconate deaminase OS=Pseudomonas sp. GN=amnD PE=1 SV=1 2 123 4.0E-10
sp|A4W923|RUTC_ENT38 Putative aminoacrylate peracid reductase RutC OS=Enterobacter sp. (strain 638) GN=rutC PE=3 SV=1 4 123 8.0E-10
sp|Q48MQ6|RUTC_PSE14 Putative aminoacrylate peracid reductase RutC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rutC PE=3 SV=1 15 123 2.0E-09
sp|Q4ZXR9|RUTC_PSEU2 Putative aminoacrylate peracid reductase RutC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rutC PE=3 SV=1 15 123 2.0E-09
sp|B7N3G6|RUTC_ECOLU Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rutC PE=3 SV=1 4 123 3.0E-09
sp|Q32HQ1|RUTC_SHIDS Putative aminoacrylate peracid reductase RutC OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|Q1RDK7|RUTC_ECOUT Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain UTI89 / UPEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B1LIZ5|RUTC_ECOSM Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|D2NGI7|RUTC_ECOS5 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O150:H5 (strain SE15) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|P0AFQ5|RUTC_ECOLI Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain K12) GN=rutC PE=1 SV=1 4 123 4.0E-09
sp|B1IV87|RUTC_ECOLC Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|P0AFQ6|RUTC_ECOL6 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rutC PE=1 SV=1 4 123 4.0E-09
sp|Q0TJ57|RUTC_ECOL5 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|D5CZH0|RUTC_ECOKI Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|A1A9R5|RUTC_ECOK1 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O1:K1 / APEC GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|A7ZYW5|RUTC_ECOHS Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O9:H4 (strain HS) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B1X9D1|RUTC_ECODH Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain K12 / DH10B) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|C9QZ66|RUTC_ECOD1 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIB 12045 / K12 / DH1) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|C4ZQD8|RUTC_ECOBW Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|C6UFC1|RUTC_ECOBR Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain B / REL606) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|C6EHJ7|RUTC_ECOBD Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain B / BL21-DE3) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B7M8Z5|RUTC_ECO8A Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O8 (strain IAI1) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B7MTF3|RUTC_ECO81 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O81 (strain ED1a) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B7NLB6|RUTC_ECO7I Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B7MIF7|RUTC_ECO45 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|D3H123|RUTC_ECO44 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O44:H18 (strain 042 / EAEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B7UNZ3|RUTC_ECO27 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|A7ZKB5|RUTC_ECO24 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|C8U5H2|RUTC_ECO10 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O103:H2 (strain 12009 / EHEC) GN=rutC PE=3 SV=1 4 123 4.0E-09
sp|B6I986|RUTC_ECOSE Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain SE11) GN=rutC PE=3 SV=1 4 123 6.0E-09
sp|B7LFC0|RUTC_ECO55 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli (strain 55989 / EAEC) GN=rutC PE=3 SV=1 4 123 1.0E-08
sp|C8TNC0|RUTC_ECO26 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O26:H11 (strain 11368 / EHEC) GN=rutC PE=3 SV=1 4 123 1.0E-08
sp|C8UMM6|RUTC_ECO1A Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O111:H- (strain 11128 / EHEC) GN=rutC PE=3 SV=1 4 123 1.0E-08
sp|D3QPK3|RUTC_ECOCB Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O55:H7 (strain CB9615 / EPEC) GN=rutC PE=3 SV=1 4 123 1.0E-08
sp|Q8XAU5|RUTC_ECO57 Putative aminoacrylate peracid reductase RutC OS=Escherichia coli O157:H7 GN=rutC PE=3 SV=1 4 123 1.0E-08
sp|P71394|Y1627_HAEIN RutC family protein HI_1627 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1627 PE=3 SV=1 30 123 3.0E-08
sp|P0AEB9|YOAB_SHIFL RutC family protein YoaB OS=Shigella flexneri GN=yoaB PE=3 SV=1 19 123 1.0E-07
sp|P0AEB7|YOAB_ECOLI RutC family protein YoaB OS=Escherichia coli (strain K12) GN=yoaB PE=3 SV=1 19 123 1.0E-07
sp|P0AEB8|YOAB_ECOL6 RutC family protein YoaB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yoaB PE=3 SV=1 19 123 1.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup959
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1690 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2281
Ophiocordyceps camponoti-floridani Ophcf2|07188
Ophiocordyceps camponoti-rufipedis Ophun1|2343
Ophiocordyceps kimflemingae Ophio5|556
Ophiocordyceps subramaniannii Hirsu2|7258

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1690
MADQTIVLSKNAPTPLGPYSQAIKTASAIYCSGQIPLTPEGDMVKGSIGDKTDQCCKNLEAVLKEAGSSMSKVVK
CNVFLSDMNHFAEMNSVYEKWFSHKPARSCVAVKTLPKNVEVEIEAIALP*
Coding >OphauG2|1690
ATGGCAGACCAAACCATCGTCCTTAGCAAAAACGCCCCAACCCCCCTGGGTCCTTATTCTCAGGCCATCAAAACC
GCATCTGCCATTTACTGCTCTGGCCAGATACCTCTGACTCCAGAGGGCGACATGGTCAAGGGATCCATCGGCGAC
AAAACAGATCAGTGTTGCAAAAACCTTGAGGCTGTACTCAAAGAGGCCGGCTCCTCCATGTCCAAGGTTGTCAAG
TGCAACGTCTTTCTCTCCGACATGAACCACTTTGCCGAAATGAATTCTGTCTATGAAAAATGGTTTTCGCATAAG
CCTGCCCGCAGCTGCGTTGCCGTCAAAACACTGCCCAAAAATGTTGAGGTGGAGATTGAGGCCATCGCTCTGCCC
TGA
Transcript >OphauG2|1690
ATGGCAGACCAAACCATCGTCCTTAGCAAAAACGCCCCAACCCCCCTGGGTCCTTATTCTCAGGCCATCAAAACC
GCATCTGCCATTTACTGCTCTGGCCAGATACCTCTGACTCCAGAGGGCGACATGGTCAAGGGATCCATCGGCGAC
AAAACAGATCAGTGTTGCAAAAACCTTGAGGCTGTACTCAAAGAGGCCGGCTCCTCCATGTCCAAGGTTGTCAAG
TGCAACGTCTTTCTCTCCGACATGAACCACTTTGCCGAAATGAATTCTGTCTATGAAAAATGGTTTTCGCATAAG
CCTGCCCGCAGCTGCGTTGCCGTCAAAACACTGCCCAAAAATGTTGAGGTGGAGATTGAGGCCATCGCTCTGCCC
TGA
Gene >OphauG2|1690
ATGGCAGACCAAACCATCGTCCTTAGCAAAAACGCCCCAACCCGTAAGTCCAGTCGCCATGTTTCATCCGCAACC
ACTACCTCCAGTTTCGCTGACCACCAGAGCTGTGCCACATAGCCCTGGGTCCTTATGTGAGTCAAGCATCGCCAT
GTCAAACCCACCTCCATCTGTACGCGTCTTGACTTTGTCATCGCCATACAGTCTCAGGCCATCAAAACCGCATCT
GCCATTTACTGCTCTGGCCAGATACCTCTGACTCCAGAGGGCGACATGGTCAAGGGATCCATCGGCGACAAAACA
GATCAGTGTTGCAAAAACCTTGAGGCTGTACTCAAAGAGGCCGGCTCCTCCATGTCCAAGGTTGTCAAGTGCAAC
GTCTTTCTCTCCGACATGAACCACTTTGCCGTCAGTAATTCTTTTTTTTTTGTGCCCATTGCATATACATCTCCT
GACAACAAGTTGCGGCGCATGCAGGAAATGAATTCTGTCTATGAAAAATGGTTTTCGCATAAGCCTGCCCGCAGC
TGCGTTGCCGTCAAAACACTGCCCAAAAATGTTGAGGTGGAGATTGAGGCCATCGCTCTGCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail