Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1687
Gene name
LocationContig_153:2910..3742
Strand+
Gene length (bp)832
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03987 Autophagy_act_C Autophagocytosis associated protein, active-site domain 6.8E-28 76 225

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8R1P4|ATG10_MOUSE Ubiquitin-like-conjugating enzyme ATG10 OS=Mus musculus GN=Atg10 PE=1 SV=1 103 228 3.0E-07
sp|Q9H0Y0|ATG10_HUMAN Ubiquitin-like-conjugating enzyme ATG10 OS=Homo sapiens GN=ATG10 PE=1 SV=1 115 228 4.0E-07
sp|Q8VZ52|ATG10_ARATH Ubiquitin-like-conjugating enzyme ATG10 OS=Arabidopsis thaliana GN=ATG10 PE=1 SV=1 97 227 3.0E-06

GO

GO Term Description Terminal node
GO:0019787 ubiquitin-like protein transferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3722
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1687 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2284
Ophiocordyceps camponoti-floridani Ophcf2|07191
Ophiocordyceps camponoti-rufipedis Ophun1|2340
Ophiocordyceps kimflemingae Ophio5|553
Ophiocordyceps subramaniannii Hirsu2|7261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1687
MDIKDFPFLSTGEFSDACHKLEASYGLAELGPRRNSWKLRLRTALGTIFYVSGTDTTYIQITCHLKPAIDSNDAL
SLDLANLQMSDPVEADDIMVELEQLDTAALKALVPHQDPELVVYEIHLHPTYRVPCLWFSLHNLASGEPSFDIDT
IFRRLVPDEYKSGLRQVGGIGSISADHHPITGVPCFFLHPCMVGDALSKFDCSTQNYLMIWLGLVGGCVGLWVPK
EMAVQ*
Coding >OphauG2|1687
ATGGATATCAAAGACTTCCCCTTCTTGTCCACAGGGGAATTTTCGGATGCCTGCCATAAACTCGAGGCCAGTTAT
GGCCTCGCAGAACTGGGTCCGCGGCGAAACAGCTGGAAGCTGAGACTTCGAACCGCACTCGGCACCATCTTTTAT
GTCTCAGGCACCGACACAACTTATATCCAAATCACTTGTCATTTGAAGCCTGCCATCGACAGCAATGATGCATTG
TCTCTTGATCTCGCCAACCTGCAAATGTCGGACCCGGTCGAGGCGGATGATATCATGGTGGAATTGGAACAGCTT
GACACGGCCGCACTCAAGGCCCTCGTGCCTCATCAGGACCCCGAGCTCGTAGTCTACGAGATTCACCTTCACCCC
ACCTATAGAGTCCCATGCCTATGGTTTAGCCTCCACAACCTGGCTTCGGGCGAGCCCTCCTTCGACATCGACACC
ATATTTCGCCGTCTGGTCCCTGACGAATATAAAAGCGGGCTTCGTCAAGTGGGCGGCATCGGAAGCATATCTGCA
GATCATCATCCCATCACAGGGGTCCCGTGTTTTTTCCTCCACCCTTGCATGGTGGGCGACGCCTTGTCCAAGTTT
GACTGCTCCACGCAAAACTATCTCATGATTTGGCTGGGGCTCGTGGGTGGTTGTGTTGGACTGTGGGTGCCCAAA
GAAATGGCCGTACAATAA
Transcript >OphauG2|1687
ATGGATATCAAAGACTTCCCCTTCTTGTCCACAGGGGAATTTTCGGATGCCTGCCATAAACTCGAGGCCAGTTAT
GGCCTCGCAGAACTGGGTCCGCGGCGAAACAGCTGGAAGCTGAGACTTCGAACCGCACTCGGCACCATCTTTTAT
GTCTCAGGCACCGACACAACTTATATCCAAATCACTTGTCATTTGAAGCCTGCCATCGACAGCAATGATGCATTG
TCTCTTGATCTCGCCAACCTGCAAATGTCGGACCCGGTCGAGGCGGATGATATCATGGTGGAATTGGAACAGCTT
GACACGGCCGCACTCAAGGCCCTCGTGCCTCATCAGGACCCCGAGCTCGTAGTCTACGAGATTCACCTTCACCCC
ACCTATAGAGTCCCATGCCTATGGTTTAGCCTCCACAACCTGGCTTCGGGCGAGCCCTCCTTCGACATCGACACC
ATATTTCGCCGTCTGGTCCCTGACGAATATAAAAGCGGGCTTCGTCAAGTGGGCGGCATCGGAAGCATATCTGCA
GATCATCATCCCATCACAGGGGTCCCGTGTTTTTTCCTCCACCCTTGCATGGTGGGCGACGCCTTGTCCAAGTTT
GACTGCTCCACGCAAAACTATCTCATGATTTGGCTGGGGCTCGTGGGTGGTTGTGTTGGACTGTGGGTGCCCAAA
GAAATGGCCGTACAATAA
Gene >OphauG2|1687
ATGGATATCAAAGACTTCCCCTTCTTGTCCACAGGGGAATTTTCGGATGCCTGCCATAAACTCGAGGCCAGTTAT
GGCCTCGCAGAACTGGGTCCGCGGCGAAACAGCTGGAAGCTGAGACTTCGAACCGCACTCGGCACCATCTTTTAT
GTCTCAGGCACCGACACAACTTATATCCAAATCACTTGTCATTTGAAGCCTGCCATCGACAGCAATGATGCATTG
TCTCTTGATCTCGCCAACCTGCAAATGTCGGACCCGGTCGAGGCGGATGATATCATGGTGGAATTGGAACAGCTT
GACACGGTATGTGCTCGAGTTCAAGCACTTGAAAATCTTGTTTCAAATGGCTCACATGCCTCGAGGCCGCACTCA
AGGCCCTCGTGCCTCATCAGGACCCCGAGCTCGTAGTCTACGAGATTCACCTTCACCCCACCTATAGAGTCCCAT
GCCTATGGTTTAGCCTCCACAACCTGGCTTCGGGCGAGCCCTCCTTCGACATCGACACCATATTTCGCCGTCTGG
TCCCTGACGAATATAAAAGCGGGCTTCGTCAAGTGGGCGGCATCGGAAGCATATCTGCAGATGTGAGTTTTGTGC
CGTCTGTCGCAGACCCGCCTCGTCAGACATGTCCGGAAAGCTAATTGATTGACAATCCTGATGGTAGCATCATCC
CATCACAGGGGTCCCGTGTTTTTTCCTCCACCCTTGCATGGTGGGCGACGCCTTGTCCAAGTTTGACTGCTCCAC
GCAAAACTATCTCATGATTTGGCTGGGGCTCGTGGGTGGTTGTGTTGGACTGTGGGTGCCCAAAGAAATGGCCGT
ACAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail