Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1674
Gene name
LocationContig_152:23872..28786
Strand+
Gene length (bp)4914
Transcript length (bp)4704
Coding sequence length (bp)4704
Protein length (aa) 1568

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 2.6E-07 304 340
PF13418 Kelch_4 Galactose oxidase, central domain 1.7E-04 249 299
PF13418 Kelch_4 Galactose oxidase, central domain 2.8E-05 307 348
PF13964 Kelch_6 Kelch motif 3.4E-10 307 358
PF13415 Kelch_3 Galactose oxidase, central domain 4.2E-07 317 364
PF01344 Kelch_1 Kelch motif 7.4E-09 307 348
PF07646 Kelch_2 Kelch motif 2.6E-06 308 352

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 123 450 2.0E-89
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 104 449 3.0E-64
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 124 450 6.0E-64
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 153 424 5.0E-32
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 192 462 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 123 450 2.0E-89
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 104 449 3.0E-64
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 124 450 6.0E-64
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 153 424 5.0E-32
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 192 462 4.0E-25
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 138 385 8.0E-23
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 193 451 2.0E-21
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 185 437 5.0E-21
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 185 437 3.0E-20
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 185 437 3.0E-20
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 190 472 4.0E-20
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 185 437 9.0E-20
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 186 488 1.0E-19
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 193 462 2.0E-19
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 236 456 7.0E-19
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 196 433 3.0E-18
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 196 433 4.0E-18
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 196 426 6.0E-18
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 190 427 6.0E-18
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 196 433 7.0E-18
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 253 427 9.0E-18
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 192 427 3.0E-17
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 237 411 5.0E-17
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 156 426 6.0E-17
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 237 433 1.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 237 433 1.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 237 433 2.0E-16
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 190 427 2.0E-16
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 186 426 2.0E-16
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 196 426 2.0E-16
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 151 417 2.0E-16
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 237 433 3.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 191 378 6.0E-16
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 249 426 7.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 191 426 8.0E-16
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 191 426 8.0E-16
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 202 406 9.0E-16
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 202 406 1.0E-15
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 202 406 1.0E-15
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 202 406 2.0E-15
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 137 426 3.0E-15
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 132 457 3.0E-15
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 137 426 3.0E-15
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 136 426 3.0E-15
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 124 339 2.0E-14
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 215 426 2.0E-14
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 132 457 3.0E-14
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 135 366 3.0E-14
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 150 436 5.0E-14
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 191 378 7.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 184 432 1.0E-13
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 294 426 2.0E-13
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 195 427 2.0E-13
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 190 427 2.0E-13
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 193 437 5.0E-13
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 189 385 5.0E-13
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 193 437 6.0E-13
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 188 446 6.0E-13
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 131 417 7.0E-13
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 129 326 1.0E-12
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 97 417 1.0E-12
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 138 417 1.0E-12
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 156 375 2.0E-12
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 191 375 2.0E-12
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 193 437 2.0E-12
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 244 456 2.0E-12
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 1 393 3.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 156 375 3.0E-12
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 262 426 3.0E-12
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 262 426 4.0E-12
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 193 451 5.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 156 375 6.0E-12
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 193 437 8.0E-12
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 304 438 9.0E-12
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 171 407 9.0E-12
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 156 380 9.0E-12
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 291 451 1.0E-11
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 304 438 1.0E-11
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 206 375 1.0E-11
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 207 433 1.0E-11
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 171 407 1.0E-11
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 123 378 2.0E-11
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 291 451 2.0E-11
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 227 378 2.0E-11
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 206 375 2.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 291 451 3.0E-11
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 291 451 3.0E-11
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 223 425 3.0E-11
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 304 438 3.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 83 267 3.0E-11
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 206 375 4.0E-11
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 193 429 5.0E-11
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 247 441 6.0E-11
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 262 426 9.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 196 435 1.0E-10
sp|Q25386|SCRB_LIMPO Beta-scruin OS=Limulus polyphemus PE=2 SV=1 207 426 3.0E-10
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 206 375 4.0E-10
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 234 426 4.0E-10
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 236 425 7.0E-10
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 191 447 7.0E-10
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 233 432 9.0E-10
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 237 425 1.0E-09
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 234 454 1.0E-09
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 247 428 1.0E-09
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 180 432 1.0E-09
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 233 432 1.0E-09
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 234 454 2.0E-09
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 184 426 2.0E-09
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 250 461 3.0E-09
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 137 417 4.0E-09
sp|Q5VV63|ATRN1_HUMAN Attractin-like protein 1 OS=Homo sapiens GN=ATRNL1 PE=2 SV=2 184 438 4.0E-09
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 334 426 4.0E-09
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 234 454 5.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 193 329 5.0E-09
sp|Q6A051|ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus GN=Atrnl1 PE=1 SV=2 184 438 5.0E-09
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 305 470 5.0E-09
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 227 379 6.0E-09
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 243 437 6.0E-09
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 241 426 6.0E-09
sp|Q80TF4|KLH13_MOUSE Kelch-like protein 13 OS=Mus musculus GN=Klhl13 PE=2 SV=3 222 426 6.0E-09
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 237 426 7.0E-09
sp|Q9P2N7|KLH13_HUMAN Kelch-like protein 13 OS=Homo sapiens GN=KLHL13 PE=1 SV=3 245 426 7.0E-09
sp|A6QQY2|KLH13_BOVIN Kelch-like protein 13 OS=Bos taurus GN=KLHL13 PE=2 SV=1 245 426 7.0E-09
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 237 426 8.0E-09
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 196 427 8.0E-09
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 205 425 9.0E-09
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 184 432 1.0E-08
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 235 414 1.0E-08
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 334 426 1.0E-08
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 191 463 1.0E-08
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 358 441 2.0E-08
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 355 448 2.0E-08
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 138 404 5.0E-08
sp|Q5ZLD3|KLH13_CHICK Kelch-like protein 13 OS=Gallus gallus GN=KLHL13 PE=2 SV=1 245 426 6.0E-08
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 191 426 6.0E-08
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 237 451 7.0E-08
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 245 426 7.0E-08
sp|Q96M94|KLH15_HUMAN Kelch-like protein 15 OS=Homo sapiens GN=KLHL15 PE=1 SV=2 195 396 7.0E-08
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 237 426 8.0E-08
sp|Q6DEL7|KLH15_DANRE Kelch-like protein 15 OS=Danio rerio GN=klhl15 PE=2 SV=1 195 396 8.0E-08
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 156 391 1.0E-07
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 245 426 1.0E-07
sp|Q9P2J3|KLHL9_HUMAN Kelch-like protein 9 OS=Homo sapiens GN=KLHL9 PE=1 SV=2 245 426 2.0E-07
sp|Q6ZPT1|KLHL9_MOUSE Kelch-like protein 9 OS=Mus musculus GN=Klhl9 PE=2 SV=2 245 426 2.0E-07
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 247 438 3.0E-07
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 247 438 3.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 342 441 3.0E-07
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 261 426 3.0E-07
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 241 438 4.0E-07
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 191 447 4.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 148 292 5.0E-07
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 305 426 8.0E-07
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 305 451 8.0E-07
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 174 325 1.0E-06
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 185 426 1.0E-06
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 190 430 1.0E-06
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 247 438 2.0E-06
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 198 347 2.0E-06
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 156 391 3.0E-06
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 188 267 4.0E-06
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 188 267 4.0E-06
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 188 267 4.0E-06
sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 250 448 4.0E-06
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 188 466 5.0E-06
sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 195 426 5.0E-06
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 190 430 5.0E-06
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 190 430 5.0E-06
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 191 376 6.0E-06
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 196 426 6.0E-06
sp|Q99JN2|KLH22_MOUSE Kelch-like protein 22 OS=Mus musculus GN=Klhl22 PE=1 SV=1 254 426 6.0E-06
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 124 392 6.0E-06
sp|Q69ZK5|KLH14_MOUSE Kelch-like protein 14 OS=Mus musculus GN=Klhl14 PE=1 SV=2 237 426 7.0E-06
sp|D3ZZC3|KLH22_RAT Kelch-like protein 22 OS=Rattus norvegicus GN=Klhl22 PE=1 SV=1 254 426 7.0E-06
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 186 375 8.0E-06
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 234 391 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3995
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1674 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5735
Ophiocordyceps camponoti-floridani Ophcf2|03447
Ophiocordyceps camponoti-rufipedis Ophun1|1724
Ophiocordyceps kimflemingae Ophio5|6012
Ophiocordyceps subramaniannii Hirsu2|7993

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1674
MAFLFKSKKNHERALASRDGNTNSSSQGSQGSIQSPVARLPREEKSALHQRSTPTGSLSSIDNDNNNGTLGSPDR
PMTHARRGGSVDNTQQQSDLPLRNGPIPSAAAAASSPAPGSQTASPYPWSQRRLTYASSSTGPFPRYGAAVNATS
SKEGDIYIMGGLINSSTVKGDLWMIEAGGNMACYPLATTAEGPGPRVGHASLLVGNAFIVYGGDTKIEESDVLDE
TLYLLNTSTRHWSRALPAGPRPAGRYGHTLNILGSKIYIFGGQVEGFFMNDLSAFDLNQLQMPNNRWELLMAGEA
SPKVPAARTNHSIITYNDKMYLFGGTNGFQWFNDVWCYDPAANAWTQLDCIGFIPAPREGHAAALVEDVMYVFGG
RTEEGTDMGDLAAFRLPSRRWYTFQNMGPSPSPRSGHSMTTVGKSIVVLGGEPSTAAPTVNDLGILYVLDTSKIR
YPNEAQVSSQRALAQARRPSTSAADMQNSPRTMAARDGSSAGPPDSRKLVSALPPSAAPLNGPKAGAQQTSTEVN
GSPSFNQPPAAAAAAAAAAASTMTAAAAPAAASASAAASASASAPTPASAPASASASAPASASAPASAPASAAST
ASSTPTTSKLPRATAAPSPAGPAPSGPATARPTVDTTGLGRVRGMSAERSGAQASPRTRSAQSPMMREAPIPESD
APAVNGQRAAPSQQAGTRGPGSGESKNRSSGPQEAGVAAEPNKVRQIRHGQSQGSVDSSTDSSSKAALRPSSPPP
PSRQTSNPISRRSSGRNSQTVALLKELDTARNKNAWYASELELARKAGYVTSANFSPTLESRAADSFDEEDRPLI
EALLTMRTELANVQSSVDKQAMVAARQVAQAEKQRDAAIQEAVYAKAKMAAHVGGSASSTPQPDSARDDTSDRTH
EVSRKLAGTLQAQKKLQSQLDSATAELEAEKRARALADDTAAVAQKRTLHLESYKQQTSSEVERLKAELHLVQRE
ARDQSVACAEAVAALALLKVDKEEVDSKYTEVLGNTKGHKETLESLKSAIVASQDARTHLEKKLEEERLQRESME
EKFNQLKAEHETRTAELATATQRLKDAQELAEKHVNEAKTHRQAVLSGLDKMSTRDVGTPTKSDAGRVAALQAQI
ATSSALVKKYKDEADAAADKLRSAEERIAGLEQYQEQSSREGVSIRRQLQSSLKEMQGLQSAHSELQNQLAAQQL
ETNAMTVQHNALKEILNERGISPTAAVRARGLASPRTASPEQTRLRDLETQLASASAAHEETKQAFAAQAQESES
AYREKLAQLESDYQSAVHYVKGTEKMLKQLKDQLSRYKTENGRLKSEVEELENRVKEHEGAAQPSAPPPEWESER
SALHKRVQVLEAELSESGNRLEKTLDDLKQQLSQSNRRRDEALRNSDEASKSLSTQRKDLEQLRSENALLEQRAT
DAEQKVSLLLDQVEHSVDNYRRRSRQAPSFNSEAVGESNGLELGHSRNESNDSGSAYEGNGLDARNSAALDNLAN
ELETLRSHWEATNKNYRLSSNFDFEQTPGARDDEEVASSMGLSKSLADWRKRLDTEDSNSEADKPSK*
Coding >OphauG2|1674
ATGGCCTTTCTCTTCAAGTCCAAAAAGAACCATGAGCGCGCATTGGCGAGCCGCGATGGAAACACAAACTCGAGC
TCGCAGGGCTCGCAGGGCTCAATCCAAAGTCCTGTTGCGCGTCTCCCTCGTGAAGAGAAGAGCGCTCTCCACCAG
CGCTCTACTCCTACCGGAAGTCTGAGCTCCATTGACAATGACAACAACAACGGCACCCTCGGCAGCCCCGACCGG
CCCATGACCCACGCCCGTCGCGGCGGAAGTGTCGACAACACGCAGCAACAGAGCGATCTACCCCTTCGAAACGGG
CCTATACCGTCTGCTGCAGCCGCAGCATCGTCTCCAGCACCTGGCAGCCAAACAGCTTCGCCGTATCCATGGTCA
CAACGCCGCCTGACATATGCCTCATCCAGCACTGGCCCCTTTCCTCGCTACGGCGCAGCCGTCAATGCTACCTCG
TCCAAGGAGGGCGACATTTACATCATGGGCGGTCTCATCAATAGCTCGACAGTCAAGGGCGACCTCTGGATGATA
GAGGCCGGAGGTAACATGGCCTGCTATCCCCTAGCCACCACGGCTGAAGGCCCGGGCCCCCGAGTTGGCCATGCC
AGCCTGCTTGTTGGCAATGCCTTTATCGTTTACGGCGGCGACACAAAGATTGAAGAGTCAGACGTCTTGGACGAG
ACGCTCTACCTCCTCAACACCTCCACGCGACACTGGTCCCGCGCCCTCCCGGCCGGCCCTCGCCCCGCAGGTCGC
TACGGCCACACTCTCAATATTCTGGGATCCAAGATATACATTTTTGGCGGCCAGGTCGAGGGCTTCTTCATGAAC
GACTTGTCCGCCTTTGACCTGAACCAACTCCAGATGCCCAACAACCGGTGGGAGCTGCTCATGGCGGGGGAGGCA
TCCCCCAAGGTGCCGGCGGCACGCACAAATCATTCCATCATCACCTACAATGACAAGATGTACCTGTTTGGCGGC
ACCAACGGTTTTCAGTGGTTCAACGATGTGTGGTGCTATGACCCGGCCGCCAATGCATGGACCCAGCTCGACTGC
ATTGGATTCATTCCGGCTCCACGCGAGGGCCACGCCGCGGCGCTTGTCGAAGACGTCATGTACGTCTTTGGCGGA
CGCACCGAAGAAGGCACCGACATGGGCGACCTGGCGGCCTTCAGGCTCCCGTCGCGCCGTTGGTACACGTTTCAG
AACATGGGGCCGTCGCCGTCGCCTCGCTCCGGCCACAGCATGACGACGGTGGGCAAGTCCATTGTCGTGCTTGGT
GGCGAGCCCAGCACGGCAGCGCCAACGGTGAACGATCTGGGCATTCTATATGTTCTCGACACCTCCAAGATTCGA
TACCCCAACGAAGCCCAGGTCAGCTCGCAAAGGGCCCTTGCTCAGGCCCGGCGGCCGAGTACGAGCGCCGCCGAC
ATGCAGAACTCGCCTCGCACCATGGCAGCGCGAGATGGCTCGTCAGCCGGTCCACCCGACTCTCGAAAGCTTGTC
AGCGCTCTTCCGCCCTCGGCCGCACCCTTGAATGGACCCAAGGCTGGCGCGCAGCAGACAAGTACCGAGGTCAAT
GGCTCGCCCAGCTTCAATCAGCCTCCTGCGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCAACAATGACAGCA
GCAGCGGCACCGGCAGCGGCATCGGCATCAGCAGCGGCGTCAGCATCAGCATCAGCACCGACACCGGCATCAGCA
CCAGCATCAGCATCAGCATCAGCACCGGCATCAGCATCAGCACCGGCATCAGCACCGGCATCAGCAGCATCAACA
GCATCATCAACACCTACAACGTCTAAACTGCCTCGTGCCACTGCTGCGCCCTCGCCTGCAGGCCCAGCTCCGTCA
GGACCTGCAACTGCCAGACCAACCGTCGACACGACTGGCCTGGGAAGGGTGCGAGGCATGTCTGCTGAACGAAGT
GGCGCCCAGGCATCTCCACGCACGAGATCGGCTCAGTCCCCCATGATGCGCGAAGCGCCCATCCCTGAAAGCGAT
GCTCCGGCAGTCAATGGACAGCGCGCCGCCCCCAGCCAACAAGCTGGTACCAGAGGCCCGGGCAGTGGCGAGAGC
AAGAATCGGAGCAGCGGTCCTCAGGAGGCGGGCGTTGCCGCTGAGCCGAACAAGGTCAGACAGATACGCCATGGC
CAGTCTCAGGGCTCTGTAGACAGCTCGACAGACTCGAGCTCAAAGGCTGCGCTGCGTCCGTCGTCTCCGCCTCCG
CCCAGCCGCCAGACCAGCAACCCCATTTCACGACGGTCATCGGGACGCAATTCCCAAACCGTGGCTCTCCTCAAA
GAGCTTGATACGGCTCGAAATAAAAACGCCTGGTATGCTTCAGAACTGGAGCTGGCACGCAAGGCAGGCTATGTC
ACGAGTGCCAACTTTAGTCCCACGCTGGAATCCAGAGCCGCCGACTCGTTTGACGAAGAGGACCGTCCCTTGATC
GAAGCCCTGTTGACGATGCGGACGGAGCTTGCCAACGTGCAGAGCTCGGTTGACAAGCAGGCAATGGTTGCCGCT
CGCCAGGTTGCCCAAGCAGAAAAGCAGCGCGACGCGGCTATCCAGGAGGCAGTCTACGCCAAGGCCAAGATGGCA
GCACACGTGGGCGGCAGTGCCAGCAGCACCCCCCAGCCAGACTCGGCGCGAGACGACACGAGCGACAGGACACAC
GAGGTTAGTCGCAAGCTGGCCGGCACGCTGCAGGCCCAGAAGAAGCTTCAGTCGCAGCTCGACAGCGCCACTGCC
GAGCTAGAGGCGGAGAAGAGGGCGCGTGCGCTTGCCGACGACACTGCCGCCGTGGCCCAGAAGCGCACCCTGCAC
CTAGAAAGCTACAAGCAACAGACGTCTTCCGAGGTGGAGCGGCTCAAGGCAGAGCTCCATCTGGTGCAACGAGAA
GCCCGGGACCAGTCGGTGGCATGTGCCGAGGCGGTTGCGGCGCTGGCTCTGCTCAAAGTCGACAAGGAAGAGGTG
GACAGCAAGTACACTGAAGTCTTGGGCAACACCAAGGGCCACAAGGAGACGCTCGAGTCGCTCAAGAGCGCCATT
GTGGCCTCGCAGGATGCCCGGACGCATCTGGAGAAGAAGCTCGAGGAGGAGCGGCTACAGAGAGAATCAATGGAG
GAAAAGTTCAACCAGCTCAAAGCAGAGCACGAAACACGCACAGCAGAGCTGGCCACGGCCACGCAACGGCTCAAG
GACGCCCAAGAACTGGCCGAGAAGCATGTCAACGAAGCAAAGACACACAGGCAGGCAGTCTTGTCGGGGCTGGAC
AAGATGTCGACGCGCGATGTTGGCACCCCAACCAAGTCGGATGCTGGCCGTGTGGCAGCTCTGCAGGCACAGATT
GCCACCTCGAGTGCCCTGGTCAAGAAGTACAAGGACGAGGCAGACGCGGCGGCCGACAAGCTGCGAAGTGCCGAG
GAGCGCATCGCCGGGCTCGAGCAATACCAAGAGCAGTCGAGTCGCGAAGGTGTGTCCATAAGAAGACAGCTCCAG
TCGTCGCTCAAGGAGATGCAGGGCTTGCAGTCGGCACATTCCGAGCTGCAGAACCAACTAGCGGCGCAGCAGCTC
GAGACGAATGCCATGACGGTACAGCACAATGCGCTCAAGGAGATTCTCAACGAGCGAGGCATCAGTCCCACGGCT
GCTGTGCGAGCTCGCGGTCTGGCAAGCCCGCGGACAGCATCGCCCGAGCAGACGCGGCTGCGAGATCTCGAGACA
CAGTTGGCCAGTGCCTCGGCGGCGCACGAGGAGACAAAGCAAGCATTTGCGGCGCAGGCACAAGAGTCGGAGAGC
GCGTACCGCGAGAAGCTTGCGCAGCTTGAGAGCGACTACCAGTCGGCCGTGCACTACGTCAAGGGAACCGAGAAG
ATGCTCAAGCAGCTCAAGGACCAGCTCTCGCGCTACAAGACGGAAAACGGGCGTCTCAAGTCGGAGGTGGAGGAG
CTTGAGAACCGGGTCAAGGAGCACGAGGGAGCGGCCCAACCGTCTGCTCCTCCGCCAGAGTGGGAGAGCGAGCGC
AGTGCTCTGCACAAGAGGGTCCAGGTTCTCGAGGCGGAGCTGAGCGAGTCGGGCAACAGACTGGAAAAGACGCTT
GACGACCTGAAGCAGCAGCTGAGCCAAAGCAACCGGCGGCGCGACGAGGCCCTGAGGAACAGCGACGAGGCCAGC
AAGAGCCTGTCGACGCAGCGCAAGGACTTGGAGCAGTTGAGGTCGGAGAATGCATTGCTGGAGCAGCGTGCCACC
GACGCCGAGCAAAAGGTGTCGTTGCTTCTTGACCAAGTCGAGCATTCCGTCGACAACTACCGCCGCCGCAGCCGC
CAAGCGCCCAGCTTCAACTCGGAAGCGGTGGGCGAGTCGAATGGGCTTGAGCTGGGCCACAGCCGTAACGAGAGC
AACGATTCGGGCAGCGCCTATGAAGGCAACGGTTTGGATGCCAGGAACAGCGCCGCCCTTGACAATCTGGCAAAT
GAGCTGGAAACACTGCGCAGCCACTGGGAAGCGACAAACAAGAATTACCGCCTCAGCTCCAACTTTGACTTTGAA
CAGACCCCAGGCGCCAGAGACGACGAAGAGGTTGCTTCCTCCATGGGGCTGAGCAAAAGCTTGGCCGACTGGAGG
AAGCGGCTCGACACTGAGGATTCCAACAGCGAAGCCGACAAGCCAAGCAAATAG
Transcript >OphauG2|1674
ATGGCCTTTCTCTTCAAGTCCAAAAAGAACCATGAGCGCGCATTGGCGAGCCGCGATGGAAACACAAACTCGAGC
TCGCAGGGCTCGCAGGGCTCAATCCAAAGTCCTGTTGCGCGTCTCCCTCGTGAAGAGAAGAGCGCTCTCCACCAG
CGCTCTACTCCTACCGGAAGTCTGAGCTCCATTGACAATGACAACAACAACGGCACCCTCGGCAGCCCCGACCGG
CCCATGACCCACGCCCGTCGCGGCGGAAGTGTCGACAACACGCAGCAACAGAGCGATCTACCCCTTCGAAACGGG
CCTATACCGTCTGCTGCAGCCGCAGCATCGTCTCCAGCACCTGGCAGCCAAACAGCTTCGCCGTATCCATGGTCA
CAACGCCGCCTGACATATGCCTCATCCAGCACTGGCCCCTTTCCTCGCTACGGCGCAGCCGTCAATGCTACCTCG
TCCAAGGAGGGCGACATTTACATCATGGGCGGTCTCATCAATAGCTCGACAGTCAAGGGCGACCTCTGGATGATA
GAGGCCGGAGGTAACATGGCCTGCTATCCCCTAGCCACCACGGCTGAAGGCCCGGGCCCCCGAGTTGGCCATGCC
AGCCTGCTTGTTGGCAATGCCTTTATCGTTTACGGCGGCGACACAAAGATTGAAGAGTCAGACGTCTTGGACGAG
ACGCTCTACCTCCTCAACACCTCCACGCGACACTGGTCCCGCGCCCTCCCGGCCGGCCCTCGCCCCGCAGGTCGC
TACGGCCACACTCTCAATATTCTGGGATCCAAGATATACATTTTTGGCGGCCAGGTCGAGGGCTTCTTCATGAAC
GACTTGTCCGCCTTTGACCTGAACCAACTCCAGATGCCCAACAACCGGTGGGAGCTGCTCATGGCGGGGGAGGCA
TCCCCCAAGGTGCCGGCGGCACGCACAAATCATTCCATCATCACCTACAATGACAAGATGTACCTGTTTGGCGGC
ACCAACGGTTTTCAGTGGTTCAACGATGTGTGGTGCTATGACCCGGCCGCCAATGCATGGACCCAGCTCGACTGC
ATTGGATTCATTCCGGCTCCACGCGAGGGCCACGCCGCGGCGCTTGTCGAAGACGTCATGTACGTCTTTGGCGGA
CGCACCGAAGAAGGCACCGACATGGGCGACCTGGCGGCCTTCAGGCTCCCGTCGCGCCGTTGGTACACGTTTCAG
AACATGGGGCCGTCGCCGTCGCCTCGCTCCGGCCACAGCATGACGACGGTGGGCAAGTCCATTGTCGTGCTTGGT
GGCGAGCCCAGCACGGCAGCGCCAACGGTGAACGATCTGGGCATTCTATATGTTCTCGACACCTCCAAGATTCGA
TACCCCAACGAAGCCCAGGTCAGCTCGCAAAGGGCCCTTGCTCAGGCCCGGCGGCCGAGTACGAGCGCCGCCGAC
ATGCAGAACTCGCCTCGCACCATGGCAGCGCGAGATGGCTCGTCAGCCGGTCCACCCGACTCTCGAAAGCTTGTC
AGCGCTCTTCCGCCCTCGGCCGCACCCTTGAATGGACCCAAGGCTGGCGCGCAGCAGACAAGTACCGAGGTCAAT
GGCTCGCCCAGCTTCAATCAGCCTCCTGCGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCAACAATGACAGCA
GCAGCGGCACCGGCAGCGGCATCGGCATCAGCAGCGGCGTCAGCATCAGCATCAGCACCGACACCGGCATCAGCA
CCAGCATCAGCATCAGCATCAGCACCGGCATCAGCATCAGCACCGGCATCAGCACCGGCATCAGCAGCATCAACA
GCATCATCAACACCTACAACGTCTAAACTGCCTCGTGCCACTGCTGCGCCCTCGCCTGCAGGCCCAGCTCCGTCA
GGACCTGCAACTGCCAGACCAACCGTCGACACGACTGGCCTGGGAAGGGTGCGAGGCATGTCTGCTGAACGAAGT
GGCGCCCAGGCATCTCCACGCACGAGATCGGCTCAGTCCCCCATGATGCGCGAAGCGCCCATCCCTGAAAGCGAT
GCTCCGGCAGTCAATGGACAGCGCGCCGCCCCCAGCCAACAAGCTGGTACCAGAGGCCCGGGCAGTGGCGAGAGC
AAGAATCGGAGCAGCGGTCCTCAGGAGGCGGGCGTTGCCGCTGAGCCGAACAAGGTCAGACAGATACGCCATGGC
CAGTCTCAGGGCTCTGTAGACAGCTCGACAGACTCGAGCTCAAAGGCTGCGCTGCGTCCGTCGTCTCCGCCTCCG
CCCAGCCGCCAGACCAGCAACCCCATTTCACGACGGTCATCGGGACGCAATTCCCAAACCGTGGCTCTCCTCAAA
GAGCTTGATACGGCTCGAAATAAAAACGCCTGGTATGCTTCAGAACTGGAGCTGGCACGCAAGGCAGGCTATGTC
ACGAGTGCCAACTTTAGTCCCACGCTGGAATCCAGAGCCGCCGACTCGTTTGACGAAGAGGACCGTCCCTTGATC
GAAGCCCTGTTGACGATGCGGACGGAGCTTGCCAACGTGCAGAGCTCGGTTGACAAGCAGGCAATGGTTGCCGCT
CGCCAGGTTGCCCAAGCAGAAAAGCAGCGCGACGCGGCTATCCAGGAGGCAGTCTACGCCAAGGCCAAGATGGCA
GCACACGTGGGCGGCAGTGCCAGCAGCACCCCCCAGCCAGACTCGGCGCGAGACGACACGAGCGACAGGACACAC
GAGGTTAGTCGCAAGCTGGCCGGCACGCTGCAGGCCCAGAAGAAGCTTCAGTCGCAGCTCGACAGCGCCACTGCC
GAGCTAGAGGCGGAGAAGAGGGCGCGTGCGCTTGCCGACGACACTGCCGCCGTGGCCCAGAAGCGCACCCTGCAC
CTAGAAAGCTACAAGCAACAGACGTCTTCCGAGGTGGAGCGGCTCAAGGCAGAGCTCCATCTGGTGCAACGAGAA
GCCCGGGACCAGTCGGTGGCATGTGCCGAGGCGGTTGCGGCGCTGGCTCTGCTCAAAGTCGACAAGGAAGAGGTG
GACAGCAAGTACACTGAAGTCTTGGGCAACACCAAGGGCCACAAGGAGACGCTCGAGTCGCTCAAGAGCGCCATT
GTGGCCTCGCAGGATGCCCGGACGCATCTGGAGAAGAAGCTCGAGGAGGAGCGGCTACAGAGAGAATCAATGGAG
GAAAAGTTCAACCAGCTCAAAGCAGAGCACGAAACACGCACAGCAGAGCTGGCCACGGCCACGCAACGGCTCAAG
GACGCCCAAGAACTGGCCGAGAAGCATGTCAACGAAGCAAAGACACACAGGCAGGCAGTCTTGTCGGGGCTGGAC
AAGATGTCGACGCGCGATGTTGGCACCCCAACCAAGTCGGATGCTGGCCGTGTGGCAGCTCTGCAGGCACAGATT
GCCACCTCGAGTGCCCTGGTCAAGAAGTACAAGGACGAGGCAGACGCGGCGGCCGACAAGCTGCGAAGTGCCGAG
GAGCGCATCGCCGGGCTCGAGCAATACCAAGAGCAGTCGAGTCGCGAAGGTGTGTCCATAAGAAGACAGCTCCAG
TCGTCGCTCAAGGAGATGCAGGGCTTGCAGTCGGCACATTCCGAGCTGCAGAACCAACTAGCGGCGCAGCAGCTC
GAGACGAATGCCATGACGGTACAGCACAATGCGCTCAAGGAGATTCTCAACGAGCGAGGCATCAGTCCCACGGCT
GCTGTGCGAGCTCGCGGTCTGGCAAGCCCGCGGACAGCATCGCCCGAGCAGACGCGGCTGCGAGATCTCGAGACA
CAGTTGGCCAGTGCCTCGGCGGCGCACGAGGAGACAAAGCAAGCATTTGCGGCGCAGGCACAAGAGTCGGAGAGC
GCGTACCGCGAGAAGCTTGCGCAGCTTGAGAGCGACTACCAGTCGGCCGTGCACTACGTCAAGGGAACCGAGAAG
ATGCTCAAGCAGCTCAAGGACCAGCTCTCGCGCTACAAGACGGAAAACGGGCGTCTCAAGTCGGAGGTGGAGGAG
CTTGAGAACCGGGTCAAGGAGCACGAGGGAGCGGCCCAACCGTCTGCTCCTCCGCCAGAGTGGGAGAGCGAGCGC
AGTGCTCTGCACAAGAGGGTCCAGGTTCTCGAGGCGGAGCTGAGCGAGTCGGGCAACAGACTGGAAAAGACGCTT
GACGACCTGAAGCAGCAGCTGAGCCAAAGCAACCGGCGGCGCGACGAGGCCCTGAGGAACAGCGACGAGGCCAGC
AAGAGCCTGTCGACGCAGCGCAAGGACTTGGAGCAGTTGAGGTCGGAGAATGCATTGCTGGAGCAGCGTGCCACC
GACGCCGAGCAAAAGGTGTCGTTGCTTCTTGACCAAGTCGAGCATTCCGTCGACAACTACCGCCGCCGCAGCCGC
CAAGCGCCCAGCTTCAACTCGGAAGCGGTGGGCGAGTCGAATGGGCTTGAGCTGGGCCACAGCCGTAACGAGAGC
AACGATTCGGGCAGCGCCTATGAAGGCAACGGTTTGGATGCCAGGAACAGCGCCGCCCTTGACAATCTGGCAAAT
GAGCTGGAAACACTGCGCAGCCACTGGGAAGCGACAAACAAGAATTACCGCCTCAGCTCCAACTTTGACTTTGAA
CAGACCCCAGGCGCCAGAGACGACGAAGAGGTTGCTTCCTCCATGGGGCTGAGCAAAAGCTTGGCCGACTGGAGG
AAGCGGCTCGACACTGAGGATTCCAACAGCGAAGCCGACAAGCCAAGCAAATAG
Gene >OphauG2|1674
ATGGCCTTTCTCTTCAAGTCCAAAAAGAACCATGAGCGCGCATTGGCGAGCCGCGATGGAAACACAAACTCGAGC
TCGCAGGGCTCGCAGGGCTCAATCCAAAGTCCTGTTGCGCGTCTCCCTCGTGAAGAGAAGAGCGCTCTCCACCAG
CGCTCTACTCCTACCGGAAGTCTGAGCTCCATTGACAATGACAACAACAACGGCACCCTCGGCAGCCCCGACCGG
CCCATGACCCACGCCCGTCGCGGCGGAAGTGTCGACAACACGCAGCAACAGAGCGATCTACCCGTAAGTACCGCC
CAGCCACGGCGTTGGAGGCAGCCGAGACATCAAGAGGCCCTGGCTCCAGCTTCTAACCTGCATTGTGCATCGACA
GCTTCGAAACGGGCCTATACCGTCTGCTGCAGCCGCAGCATCGTCTCCAGCACCTGGCAGCCAAACAGCTTCGCC
GTATCCATGGTCACAACGCCGCCTGACATATGCCTCATCCAGCACTGGCCCCTTTCCTCGCTACGGCGCAGCCGT
CAATGCTACCTCGTCCAAGGAGGGCGACATTTACATCATGGGCGGTCTCATCAATAGCTCGACAGTCAAGGGCGA
CCTCTGGATGATAGAGGCCGGAGGTAACATGGCCTGCTATCCCCTAGCCACCACGGCTGAAGGCCCGGGCCCCCG
AGTTGGCCATGCCAGCCTGCTTGTTGGCAATGCCTTTATCGTTTACGGCGGCGACACAAAGATTGAAGAGTCAGA
CGTCTTGGACGAGACGCTCTACCTCCTCAACACCTGTTAGTACAATGCAAGCCTAGCTCGAGTCGTACCACATTG
CTGATGCCTGTGTTGCAGCCACGCGACACTGGTCCCGCGCCCTCCCGGCCGGCCCTCGCCCCGCAGGTCGCTACG
GCCACACTCTCAATATTCTGGGATCCAAGATATACATTTTTGGCGGCCAGGTCGAGGGCTTCTTCATGAACGACT
TGTCCGCCTTTGACCTGAACCAACTCCAGATGCCCAACAACCGGTGGGAGCTGCTCATGGCGGGGGAGGCATCCC
CCAAGGTGCCGGCGGCACGCACAAATCATTCCATCATCACCTACAATGACAAGATGTACCTGTAAGTCTCCCCAA
CACTCGCCTCGTCTCTGGAGCAGCCTGACTCAAGGACTGTCTGCTACTAGGTTTGGCGGCACCAACGGTTTTCAG
TGGTTCAACGATGTGTGGTGCTATGACCCGGCCGCCAATGCATGGACCCAGCTCGACTGCATTGGATTCATTCCG
GCTCCACGCGAGGGCCACGCCGCGGCGCTTGTCGAAGACGTCATGTACGTCTTTGGCGGACGCACCGAAGAAGGC
ACCGACATGGGCGACCTGGCGGCCTTCAGGCTCCCGTCGCGCCGTTGGTACACGTTTCAGAACATGGGGCCGTCG
CCGTCGCCTCGCTCCGGCCACAGCATGACGACGGTGGGCAAGTCCATTGTCGTGCTTGGTGGCGAGCCCAGCACG
GCAGCGCCAACGGTGAACGATCTGGGCATTCTATATGTTCTCGACACCTCCAAGATTCGATACCCCAACGAAGCC
CAGGTCAGCTCGCAAAGGGCCCTTGCTCAGGCCCGGCGGCCGAGTACGAGCGCCGCCGACATGCAGAACTCGCCT
CGCACCATGGCAGCGCGAGATGGCTCGTCAGCCGGTCCACCCGACTCTCGAAAGCTTGTCAGCGCTCTTCCGCCC
TCGGCCGCACCCTTGAATGGACCCAAGGCTGGCGCGCAGCAGACAAGTACCGAGGTCAATGGCTCGCCCAGCTTC
AATCAGCCTCCTGCGGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCAACAATGACAGCAGCAGCGGCACCGGCA
GCGGCATCGGCATCAGCAGCGGCGTCAGCATCAGCATCAGCACCGACACCGGCATCAGCACCAGCATCAGCATCA
GCATCAGCACCGGCATCAGCATCAGCACCGGCATCAGCACCGGCATCAGCAGCATCAACAGCATCATCAACACCT
ACAACGTCTAAACTGCCTCGTGCCACTGCTGCGCCCTCGCCTGCAGGCCCAGCTCCGTCAGGACCTGCAACTGCC
AGACCAACCGTCGACACGACTGGCCTGGGAAGGGTGCGAGGCATGTCTGCTGAACGAAGTGGCGCCCAGGCATCT
CCACGCACGAGATCGGCTCAGTCCCCCATGATGCGCGAAGCGCCCATCCCTGAAAGCGATGCTCCGGCAGTCAAT
GGACAGCGCGCCGCCCCCAGCCAACAAGCTGGTACCAGAGGCCCGGGCAGTGGCGAGAGCAAGAATCGGAGCAGC
GGTCCTCAGGAGGCGGGCGTTGCCGCTGAGCCGAACAAGGTCAGACAGATACGCCATGGCCAGTCTCAGGGCTCT
GTAGACAGCTCGACAGACTCGAGCTCAAAGGCTGCGCTGCGTCCGTCGTCTCCGCCTCCGCCCAGCCGCCAGACC
AGCAACCCCATTTCACGACGGTCATCGGGACGCAATTCCCAAACCGTGGCTCTCCTCAAAGAGCTTGATACGGCT
CGAAATAAAAACGCCTGGTATGCTTCAGAACTGGAGCTGGCACGCAAGGCAGGCTATGTCACGAGTGCCAACTTT
AGTCCCACGCTGGAATCCAGAGCCGCCGACTCGTTTGACGAAGAGGACCGTCCCTTGATCGAAGCCCTGTTGACG
ATGCGGACGGAGCTTGCCAACGTGCAGAGCTCGGTTGACAAGCAGGCAATGGTTGCCGCTCGCCAGGTTGCCCAA
GCAGAAAAGCAGCGCGACGCGGCTATCCAGGAGGCAGTCTACGCCAAGGCCAAGATGGCAGCACACGTGGGCGGC
AGTGCCAGCAGCACCCCCCAGCCAGACTCGGCGCGAGACGACACGAGCGACAGGACACACGAGGTTAGTCGCAAG
CTGGCCGGCACGCTGCAGGCCCAGAAGAAGCTTCAGTCGCAGCTCGACAGCGCCACTGCCGAGCTAGAGGCGGAG
AAGAGGGCGCGTGCGCTTGCCGACGACACTGCCGCCGTGGCCCAGAAGCGCACCCTGCACCTAGAAAGCTACAAG
CAACAGACGTCTTCCGAGGTGGAGCGGCTCAAGGCAGAGCTCCATCTGGTGCAACGAGAAGCCCGGGACCAGTCG
GTGGCATGTGCCGAGGCGGTTGCGGCGCTGGCTCTGCTCAAAGTCGACAAGGAAGAGGTGGACAGCAAGTACACT
GAAGTCTTGGGCAACACCAAGGGCCACAAGGAGACGCTCGAGTCGCTCAAGAGCGCCATTGTGGCCTCGCAGGAT
GCCCGGACGCATCTGGAGAAGAAGCTCGAGGAGGAGCGGCTACAGAGAGAATCAATGGAGGAAAAGTTCAACCAG
CTCAAAGCAGAGCACGAAACACGCACAGCAGAGCTGGCCACGGCCACGCAACGGCTCAAGGACGCCCAAGAACTG
GCCGAGAAGCATGTCAACGAAGCAAAGACACACAGGCAGGCAGTCTTGTCGGGGCTGGACAAGATGTCGACGCGC
GATGTTGGCACCCCAACCAAGTCGGATGCTGGCCGTGTGGCAGCTCTGCAGGCACAGATTGCCACCTCGAGTGCC
CTGGTCAAGAAGTACAAGGACGAGGCAGACGCGGCGGCCGACAAGCTGCGAAGTGCCGAGGAGCGCATCGCCGGG
CTCGAGCAATACCAAGAGCAGTCGAGTCGCGAAGGTGTGTCCATAAGAAGACAGCTCCAGTCGTCGCTCAAGGAG
ATGCAGGGCTTGCAGTCGGCACATTCCGAGCTGCAGAACCAACTAGCGGCGCAGCAGCTCGAGACGAATGCCATG
ACGGTACAGCACAATGCGCTCAAGGAGATTCTCAACGAGCGAGGCATCAGTCCCACGGCTGCTGTGCGAGCTCGC
GGTCTGGCAAGCCCGCGGACAGCATCGCCCGAGCAGACGCGGCTGCGAGATCTCGAGACACAGTTGGCCAGTGCC
TCGGCGGCGCACGAGGAGACAAAGCAAGCATTTGCGGCGCAGGCACAAGAGTCGGAGAGCGCGTACCGCGAGAAG
CTTGCGCAGCTTGAGAGCGACTACCAGTCGGCCGTGCACTACGTCAAGGGAACCGAGAAGATGCTCAAGCAGCTC
AAGGACCAGCTCTCGCGCTACAAGACGGAAAACGGGCGTCTCAAGTCGGAGGTGGAGGAGCTTGAGAACCGGGTC
AAGGAGCACGAGGGAGCGGCCCAACCGTCTGCTCCTCCGCCAGAGTGGGAGAGCGAGCGCAGTGCTCTGCACAAG
AGGGTCCAGGTTCTCGAGGCGGAGCTGAGCGAGTCGGGCAACAGACTGGAAAAGACGCTTGACGACCTGAAGCAG
CAGCTGAGCCAAAGCAACCGGCGGCGCGACGAGGCCCTGAGGAACAGCGACGAGGCCAGCAAGAGCCTGTCGACG
CAGCGCAAGGACTTGGAGCAGTTGAGGTCGGAGAATGCATTGCTGGAGCAGCGTGCCACCGACGCCGAGCAAAAG
GTGTCGTTGCTTCTTGACCAAGTCGAGCATTCCGTCGACAACTACCGCCGCCGCAGCCGCCAAGCGCCCAGCTTC
AACTCGGAAGCGGTGGGCGAGTCGAATGGGCTTGAGCTGGGCCACAGCCGTAACGAGAGCAACGATTCGGGCAGC
GCCTATGAAGGCAACGGTTTGGATGCCAGGAACAGCGCCGCCCTTGACAATCTGGCAAATGAGCTGGAAACACTG
CGCAGCCACTGGGAAGCGACAAACAAGAATTACCGCCTCAGCTCCAACTTTGACTTTGAACAGACCCCAGGCGCC
AGAGACGACGAAGAGGTTGCTTCCTCCATGGGGCTGAGCAAAAGCTTGGCCGACTGGAGGAAGCGGCTCGACACT
GAGGATTCCAACAGCGAAGCCGACAAGCCAAGCAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail