Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1673
Gene name
LocationContig_152:16339..21290
Strand-
Gene length (bp)4951
Transcript length (bp)4515
Coding sequence length (bp)4515
Protein length (aa) 1505

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14538 Raptor_N Raptor N-terminal CASPase like domain 2.0E-63 264 414

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K4Q0|RPTOR_MOUSE Regulatory-associated protein of mTOR OS=Mus musculus GN=Rptor PE=1 SV=1 231 912 0.0E+00
sp|P87141|MIP1_SCHPO WD repeat-containing protein mip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mip1 PE=1 SV=1 212 1504 0.0E+00
sp|Q9LZW9|RTOR2_ARATH Regulatory-associated protein of TOR 2 OS=Arabidopsis thaliana GN=RAPTOR2 PE=2 SV=2 257 884 0.0E+00
sp|Q0IQN5|RTOR1_ORYSJ Regulatory-associated protein of TOR 1 OS=Oryza sativa subsp. japonica GN=RAPTOR1 PE=2 SV=2 254 944 0.0E+00
sp|Q93YQ1|RTOR1_ARATH Regulatory-associated protein of TOR 1 OS=Arabidopsis thaliana GN=RAPTOR1 PE=1 SV=1 240 894 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K4Q0|RPTOR_MOUSE Regulatory-associated protein of mTOR OS=Mus musculus GN=Rptor PE=1 SV=1 231 912 0.0E+00
sp|P87141|MIP1_SCHPO WD repeat-containing protein mip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mip1 PE=1 SV=1 212 1504 0.0E+00
sp|Q9LZW9|RTOR2_ARATH Regulatory-associated protein of TOR 2 OS=Arabidopsis thaliana GN=RAPTOR2 PE=2 SV=2 257 884 0.0E+00
sp|Q0IQN5|RTOR1_ORYSJ Regulatory-associated protein of TOR 1 OS=Oryza sativa subsp. japonica GN=RAPTOR1 PE=2 SV=2 254 944 0.0E+00
sp|Q93YQ1|RTOR1_ARATH Regulatory-associated protein of TOR 1 OS=Arabidopsis thaliana GN=RAPTOR1 PE=1 SV=1 240 894 0.0E+00
sp|Q8N122|RPTOR_HUMAN Regulatory-associated protein of mTOR OS=Homo sapiens GN=RPTOR PE=1 SV=1 231 913 0.0E+00
sp|C7J8E5|RTOR2_ORYSJ Regulatory-associated protein of TOR 2 OS=Oryza sativa subsp. japonica GN=RAPTOR2 PE=2 SV=2 301 944 4.0E-175
sp|Q55BR7|RPTOR_DICDI Protein raptor homolog OS=Dictyostelium discoideum GN=raptor PE=1 SV=1 441 980 9.0E-141
sp|P38873|KOG1_YEAST Target of rapamycin complex 1 subunit KOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KOG1 PE=1 SV=2 212 594 1.0E-128
sp|P38873|KOG1_YEAST Target of rapamycin complex 1 subunit KOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KOG1 PE=1 SV=2 859 1496 1.0E-127
sp|Q55BR7|RPTOR_DICDI Protein raptor homolog OS=Dictyostelium discoideum GN=raptor PE=1 SV=1 235 424 6.0E-68
sp|Q8K4Q0|RPTOR_MOUSE Regulatory-associated protein of mTOR OS=Mus musculus GN=Rptor PE=1 SV=1 940 1497 2.0E-65
sp|Q8N122|RPTOR_HUMAN Regulatory-associated protein of mTOR OS=Homo sapiens GN=RPTOR PE=1 SV=1 940 1497 3.0E-65
sp|Q55BR7|RPTOR_DICDI Protein raptor homolog OS=Dictyostelium discoideum GN=raptor PE=1 SV=1 1114 1504 3.0E-47
sp|P38873|KOG1_YEAST Target of rapamycin complex 1 subunit KOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KOG1 PE=1 SV=2 614 841 5.0E-47
sp|Q93YQ1|RTOR1_ARATH Regulatory-associated protein of TOR 1 OS=Arabidopsis thaliana GN=RAPTOR1 PE=1 SV=1 1111 1499 1.0E-37
sp|C7J8E5|RTOR2_ORYSJ Regulatory-associated protein of TOR 2 OS=Oryza sativa subsp. japonica GN=RAPTOR2 PE=2 SV=2 1097 1493 1.0E-35
sp|Q9LZW9|RTOR2_ARATH Regulatory-associated protein of TOR 2 OS=Arabidopsis thaliana GN=RAPTOR2 PE=2 SV=2 1115 1499 3.0E-35
sp|Q0IQN5|RTOR1_ORYSJ Regulatory-associated protein of TOR 1 OS=Oryza sativa subsp. japonica GN=RAPTOR1 PE=2 SV=2 1097 1493 3.0E-33
sp|Q0DJA3|DRB3_ORYSJ Double-stranded RNA-binding protein 3 OS=Oryza sativa subsp. japonica GN=DRB3 PE=2 SV=1 259 338 2.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3994
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1673 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5736
Ophiocordyceps camponoti-floridani Ophcf2|03446
Ophiocordyceps camponoti-rufipedis Ophun1|1723
Ophiocordyceps kimflemingae Ophio5|6013
Ophiocordyceps subramaniannii Hirsu2|7991

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1673
MTVVPGQRQHQQQQPSQTAPSPLHQPRLVDAAPSATAKHPSSSSSSSSSSVVSSSTSSSEPTLLGPALSRTRPAL
PRQLLHGPQQPADMTLRHDLRRGSLPTTPRPDSHTDSSSDQHSQPMRPLPTPAYRRRPLTAAGLQLHGQDTLPAE
NGCLQDAGDALSDWPAPAPQPPAVDDSLARLKKPQLLRSKSDFIDYDAAPDQEPQLREWGARHGFDGHYQSEHVI
SELVNNWYMYYTDKRHETTGKPKPLKYELQDWRQRDRLKTISAALAVCLNIGVEPPDQLKTTPGAKLEAWTDPTV
PPVQKALDNIGKALQSQYETLAIRARYKQYLDPTFEETKKFCVSLRRNAKDERVLLHYNGHGVPKPTVSGEIWVF
NKTYTQYIPVSLYDLQNWLQAPTIFVWDCSEAGNILNNYHRFVDKHDDEENEAAERDAHYEKTNFRPYIHLAACA
VKENLPTNPLLPADLFTACLTTPIEMALWFFVLQNPLKTNLTPERAKQLPGRLQERRTPLGELNWIFTAITDSIA
WTTLPRDLFRKFFRQDLMVAALFRNFLLAQRVMAVYGCHPQSYPALPDTHQHPLWATWDLAVDMALAQLPMMESK
EGEGVDYEYQNSTFFTEQLTAFDVYLTRGDAMEQKPPDQLPVVLQVLLSQQHRVRALILLGRFLDLGPWSVQLAL
SIGIFPYVLKLLQSAASELKPVMVYIWARLIAVDISCQQDLIKDNGYSYFAQILKPSEGLPVVDSDEHKAMCAFI
LAMLCKDYRNGQVVCNQTDVMSYCLAHLHNENNPLLRQWACLCLSQLWQDLVEAKWRGIRENAYVKLAYLMRDPC
CEVRAAMIHAMTSFIGIPDLTDEVARIEESIAWTLLEMGNDGSPVVRKEFLVFLSHFVLRFENKFLVAAFEQLLE
EKEHLVSPSADDSHDYKTGLHNAKSSNRNKDAAVKAMSHGLSQHTVYMACWKHALILSVDPHPEVRREATIMVDY
VHSTLLKSSVKEAAQALMRDLQRRSQKAASVRQAAYTVQRNGVRGTPNVAPPPSPGLLRRTASLLFPSFAGLEDK
PKSNSQPHAMLVKSASVKMSADQVSAPPEQTDQPKALAAYGVAPEPASGAYQKRNLDIAPFLPLRSQFLEWSIEY
FREPQMKASEADEPGSTDYNARLWRRARNEAVLRETQPLKQHAGSHKWNNQLGLINNGAQPAKMAFHQYEDHLAV
CDDGNTVCIWDWKKQGRLNRFSNGNPEGSKISDIKYINEDDQALLMTGSSDGVMRVYRDYDCEDMQLATSWRALT
HMVPSNVNSGMVFDWQQVTGRVLVAGDVRVIRVWYAAHETCIMDIPARSGSCVTSLTSDQMTGNMFVAGFGDGAV
RVFDTRQRPQDSMVRKWKDDSDRQWIKSVHMQRGGQRELLSASRNGKVKVWDVRMDEPLHVFGTTRDTLRTMSTH
EHLPVFAVGTSQHTVKVFNLDGNELSRLEPYSSFLHQTRGGVISTTAFHPHRPVLGCAARGDQHINLYTCERTEP
LHLD*
Coding >OphauG2|1673
ATGACTGTCGTACCAGGCCAGCGCCAGCACCAACAGCAGCAGCCATCGCAGACGGCGCCGTCTCCACTCCACCAG
CCCCGTCTTGTCGATGCAGCTCCTTCGGCCACTGCCAAGCACCCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCC
GTGGTGTCGTCGTCGACGTCGTCGTCTGAGCCGACTCTGCTTGGGCCAGCCTTGTCGCGCACGCGCCCAGCCCTC
CCCCGACAACTGCTCCATGGACCTCAGCAGCCTGCAGACATGACGCTGCGACACGACTTGCGCCGCGGCTCGCTG
CCCACCACGCCCAGACCCGACTCCCACACCGACAGCAGCTCCGACCAGCACTCGCAGCCCATGCGGCCGCTGCCT
ACTCCCGCCTACCGCCGCCGGCCCTTGACCGCTGCCGGCCTCCAGCTCCATGGCCAGGACACGCTGCCTGCTGAG
AATGGCTGCCTGCAAGACGCTGGCGACGCCCTGTCAGATTGGCCGGCCCCTGCACCACAGCCCCCCGCCGTCGAC
GACTCCCTGGCACGCCTCAAGAAGCCCCAGCTGCTGCGCTCCAAAAGCGACTTCATCGACTACGATGCTGCTCCA
GACCAGGAGCCCCAATTGCGCGAGTGGGGAGCCCGCCATGGCTTTGACGGCCACTATCAATCCGAGCATGTAATC
TCTGAACTCGTCAACAACTGGTACATGTACTATACCGATAAACGCCACGAGACAACAGGCAAGCCCAAGCCTCTC
AAATATGAGCTGCAGGACTGGCGCCAACGCGATCGTCTCAAGACCATCTCGGCTGCCCTGGCCGTCTGTCTCAAC
ATTGGCGTGGAGCCTCCAGATCAGCTCAAGACAACTCCCGGCGCAAAGCTCGAGGCCTGGACAGACCCCACTGTT
CCACCTGTGCAAAAGGCACTCGACAACATTGGCAAGGCTCTGCAGTCGCAGTACGAGACGCTAGCCATTCGAGCC
CGCTACAAGCAGTACCTAGATCCAACATTTGAAGAGACCAAAAAGTTTTGCGTCTCGCTACGCCGCAACGCCAAA
GACGAGCGCGTTCTCTTGCATTACAATGGCCACGGCGTTCCAAAGCCCACCGTGTCGGGCGAGATATGGGTCTTC
AACAAGACGTACACACAGTATATTCCCGTCAGCCTCTACGATTTGCAAAATTGGCTGCAGGCCCCAACCATTTTT
GTCTGGGACTGCTCAGAGGCAGGCAACATACTCAATAATTACCACCGCTTCGTGGACAAGCACGACGACGAGGAG
AATGAGGCTGCCGAGAGAGATGCGCATTACGAAAAGACTAATTTTCGCCCCTATATCCATCTAGCCGCCTGCGCC
GTCAAGGAAAACCTGCCCACCAATCCCCTGCTGCCAGCCGACCTCTTCACGGCTTGTCTCACCACCCCTATTGAA
ATGGCTCTCTGGTTCTTTGTCCTGCAGAATCCCCTAAAGACCAACTTGACCCCGGAGCGAGCCAAGCAGCTGCCT
GGCCGGCTTCAGGAGCGTCGCACGCCACTTGGCGAGCTCAACTGGATCTTTACCGCCATTACGGACAGCATCGCC
TGGACCACTTTGCCCCGCGATTTGTTTCGCAAGTTTTTCCGCCAGGACCTCATGGTGGCGGCTCTCTTTCGCAAT
TTTCTTCTCGCGCAGCGCGTCATGGCTGTCTACGGCTGCCATCCACAGTCGTATCCTGCTCTTCCCGATACGCAC
CAGCACCCCCTCTGGGCAACCTGGGACTTGGCAGTTGACATGGCGCTGGCTCAGCTTCCCATGATGGAGAGCAAG
GAGGGCGAGGGCGTCGACTACGAATACCAGAATTCAACCTTCTTCACCGAGCAGCTTACGGCTTTTGATGTTTAC
CTCACCCGAGGCGATGCCATGGAGCAGAAGCCCCCCGACCAGCTCCCCGTCGTGCTGCAGGTGTTGCTAAGCCAG
CAGCATAGAGTGCGCGCCCTAATTCTGCTCGGCAGGTTCCTCGACCTCGGCCCATGGTCCGTTCAGCTAGCCCTC
AGCATCGGCATCTTTCCATATGTCCTCAAACTACTGCAATCTGCTGCGTCAGAGCTCAAGCCTGTCATGGTGTAC
ATTTGGGCCAGACTCATTGCTGTCGACATTTCGTGTCAGCAAGATCTCATCAAGGATAATGGCTATAGCTACTTT
GCGCAGATTCTCAAGCCCTCCGAGGGCCTTCCGGTTGTCGACAGCGACGAACACAAGGCCATGTGCGCCTTTATT
CTTGCCATGCTTTGCAAGGACTATCGAAACGGCCAGGTTGTGTGCAACCAGACAGACGTCATGTCGTACTGTCTT
GCACATTTGCACAATGAAAACAACCCGTTGCTGCGCCAGTGGGCTTGTCTCTGTCTCAGTCAACTCTGGCAAGAT
CTCGTCGAGGCCAAGTGGCGCGGCATTCGTGAGAATGCCTATGTCAAGCTGGCCTACCTGATGCGCGACCCCTGC
TGCGAGGTGCGGGCTGCCATGATACACGCCATGACATCCTTTATTGGCATTCCAGACTTGACGGACGAAGTTGCT
CGCATCGAGGAATCCATCGCCTGGACTCTGCTTGAAATGGGCAATGATGGAAGTCCCGTGGTGCGCAAAGAGTTT
CTTGTCTTCCTCTCACATTTCGTGCTGCGTTTTGAGAACAAGTTTCTGGTGGCGGCTTTTGAACAGCTGTTGGAG
GAAAAGGAGCACCTCGTGTCACCAAGTGCGGACGACAGCCACGACTACAAAACGGGCCTGCACAACGCCAAGTCT
AGCAATAGGAACAAGGACGCCGCTGTCAAGGCCATGAGTCACGGGCTGTCGCAGCATACAGTCTACATGGCGTGT
TGGAAGCACGCTCTGATTCTCAGCGTTGATCCTCACCCCGAGGTACGGCGAGAGGCGACAATCATGGTGGACTAT
GTGCACAGCACCCTCTTGAAATCGAGTGTCAAGGAGGCCGCACAGGCTCTCATGCGGGATCTTCAGCGGCGATCG
CAAAAGGCGGCGTCGGTTAGGCAGGCAGCTTACACTGTACAGCGCAATGGTGTACGAGGCACCCCAAACGTCGCT
CCACCTCCGTCCCCCGGCCTCTTGCGGCGGACGGCCAGTCTCCTGTTTCCTTCATTTGCCGGCCTCGAAGACAAG
CCCAAGTCCAACTCGCAGCCGCATGCCATGCTGGTCAAGTCGGCGTCGGTCAAGATGTCTGCAGACCAAGTCTCG
GCGCCACCCGAGCAGACTGACCAGCCCAAGGCGCTGGCGGCATATGGTGTGGCGCCTGAGCCGGCGTCGGGGGCA
TATCAAAAACGCAACCTTGACATTGCGCCTTTTTTGCCGCTCAGGAGCCAGTTTCTAGAGTGGTCTATTGAGTAC
TTTCGAGAGCCGCAGATGAAGGCTAGCGAGGCTGATGAGCCGGGAAGCACCGACTACAATGCCCGGCTTTGGCGG
CGGGCGCGCAACGAAGCAGTGCTGCGCGAGACACAGCCACTAAAGCAGCATGCCGGCAGTCACAAGTGGAACAAC
CAGCTAGGTCTCATCAACAACGGAGCGCAACCAGCAAAGATGGCTTTTCATCAGTACGAAGACCACCTGGCCGTG
TGCGACGACGGCAACACGGTGTGCATCTGGGATTGGAAGAAGCAGGGCCGCCTCAACCGCTTCAGCAACGGAAAC
CCCGAGGGCTCCAAGATCAGCGACATCAAGTACATCAATGAGGACGACCAGGCCCTTCTCATGACGGGTTCGTCG
GACGGCGTGATGCGCGTTTACCGAGACTACGATTGCGAGGACATGCAGCTAGCAACGTCGTGGCGAGCCCTGACG
CACATGGTTCCCAGCAACGTCAACTCGGGCATGGTGTTTGACTGGCAGCAGGTGACGGGCCGCGTCTTGGTGGCA
GGCGATGTGCGCGTGATTCGCGTGTGGTACGCGGCACACGAGACGTGCATCATGGACATTCCTGCTAGATCGGGA
TCGTGCGTGACGTCGCTGACGTCGGACCAGATGACGGGCAACATGTTTGTTGCTGGCTTTGGCGATGGTGCGGTG
CGCGTCTTTGACACGCGGCAACGCCCGCAGGATTCAATGGTGCGCAAGTGGAAGGATGACTCGGACCGGCAGTGG
ATCAAGAGCGTGCACATGCAGCGCGGCGGGCAGCGAGAGCTCCTGAGCGCCAGTCGCAACGGCAAGGTCAAGGTG
TGGGATGTGCGCATGGACGAGCCGTTGCATGTTTTTGGCACCACGCGCGACACGCTGCGCACCATGAGCACCCAT
GAACACTTGCCCGTCTTTGCTGTAGGAACTTCCCAGCACACGGTCAAGGTGTTTAATCTCGACGGCAACGAGCTC
TCACGCCTGGAGCCATACTCGAGCTTCCTGCATCAGACGCGCGGAGGCGTTATATCGACCACGGCCTTCCACCCA
CACCGGCCCGTGCTGGGCTGCGCAGCGCGAGGCGACCAGCACATAAACCTGTATACTTGCGAGAGGACGGAGCCT
CTGCACCTGGATTAG
Transcript >OphauG2|1673
ATGACTGTCGTACCAGGCCAGCGCCAGCACCAACAGCAGCAGCCATCGCAGACGGCGCCGTCTCCACTCCACCAG
CCCCGTCTTGTCGATGCAGCTCCTTCGGCCACTGCCAAGCACCCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCC
GTGGTGTCGTCGTCGACGTCGTCGTCTGAGCCGACTCTGCTTGGGCCAGCCTTGTCGCGCACGCGCCCAGCCCTC
CCCCGACAACTGCTCCATGGACCTCAGCAGCCTGCAGACATGACGCTGCGACACGACTTGCGCCGCGGCTCGCTG
CCCACCACGCCCAGACCCGACTCCCACACCGACAGCAGCTCCGACCAGCACTCGCAGCCCATGCGGCCGCTGCCT
ACTCCCGCCTACCGCCGCCGGCCCTTGACCGCTGCCGGCCTCCAGCTCCATGGCCAGGACACGCTGCCTGCTGAG
AATGGCTGCCTGCAAGACGCTGGCGACGCCCTGTCAGATTGGCCGGCCCCTGCACCACAGCCCCCCGCCGTCGAC
GACTCCCTGGCACGCCTCAAGAAGCCCCAGCTGCTGCGCTCCAAAAGCGACTTCATCGACTACGATGCTGCTCCA
GACCAGGAGCCCCAATTGCGCGAGTGGGGAGCCCGCCATGGCTTTGACGGCCACTATCAATCCGAGCATGTAATC
TCTGAACTCGTCAACAACTGGTACATGTACTATACCGATAAACGCCACGAGACAACAGGCAAGCCCAAGCCTCTC
AAATATGAGCTGCAGGACTGGCGCCAACGCGATCGTCTCAAGACCATCTCGGCTGCCCTGGCCGTCTGTCTCAAC
ATTGGCGTGGAGCCTCCAGATCAGCTCAAGACAACTCCCGGCGCAAAGCTCGAGGCCTGGACAGACCCCACTGTT
CCACCTGTGCAAAAGGCACTCGACAACATTGGCAAGGCTCTGCAGTCGCAGTACGAGACGCTAGCCATTCGAGCC
CGCTACAAGCAGTACCTAGATCCAACATTTGAAGAGACCAAAAAGTTTTGCGTCTCGCTACGCCGCAACGCCAAA
GACGAGCGCGTTCTCTTGCATTACAATGGCCACGGCGTTCCAAAGCCCACCGTGTCGGGCGAGATATGGGTCTTC
AACAAGACGTACACACAGTATATTCCCGTCAGCCTCTACGATTTGCAAAATTGGCTGCAGGCCCCAACCATTTTT
GTCTGGGACTGCTCAGAGGCAGGCAACATACTCAATAATTACCACCGCTTCGTGGACAAGCACGACGACGAGGAG
AATGAGGCTGCCGAGAGAGATGCGCATTACGAAAAGACTAATTTTCGCCCCTATATCCATCTAGCCGCCTGCGCC
GTCAAGGAAAACCTGCCCACCAATCCCCTGCTGCCAGCCGACCTCTTCACGGCTTGTCTCACCACCCCTATTGAA
ATGGCTCTCTGGTTCTTTGTCCTGCAGAATCCCCTAAAGACCAACTTGACCCCGGAGCGAGCCAAGCAGCTGCCT
GGCCGGCTTCAGGAGCGTCGCACGCCACTTGGCGAGCTCAACTGGATCTTTACCGCCATTACGGACAGCATCGCC
TGGACCACTTTGCCCCGCGATTTGTTTCGCAAGTTTTTCCGCCAGGACCTCATGGTGGCGGCTCTCTTTCGCAAT
TTTCTTCTCGCGCAGCGCGTCATGGCTGTCTACGGCTGCCATCCACAGTCGTATCCTGCTCTTCCCGATACGCAC
CAGCACCCCCTCTGGGCAACCTGGGACTTGGCAGTTGACATGGCGCTGGCTCAGCTTCCCATGATGGAGAGCAAG
GAGGGCGAGGGCGTCGACTACGAATACCAGAATTCAACCTTCTTCACCGAGCAGCTTACGGCTTTTGATGTTTAC
CTCACCCGAGGCGATGCCATGGAGCAGAAGCCCCCCGACCAGCTCCCCGTCGTGCTGCAGGTGTTGCTAAGCCAG
CAGCATAGAGTGCGCGCCCTAATTCTGCTCGGCAGGTTCCTCGACCTCGGCCCATGGTCCGTTCAGCTAGCCCTC
AGCATCGGCATCTTTCCATATGTCCTCAAACTACTGCAATCTGCTGCGTCAGAGCTCAAGCCTGTCATGGTGTAC
ATTTGGGCCAGACTCATTGCTGTCGACATTTCGTGTCAGCAAGATCTCATCAAGGATAATGGCTATAGCTACTTT
GCGCAGATTCTCAAGCCCTCCGAGGGCCTTCCGGTTGTCGACAGCGACGAACACAAGGCCATGTGCGCCTTTATT
CTTGCCATGCTTTGCAAGGACTATCGAAACGGCCAGGTTGTGTGCAACCAGACAGACGTCATGTCGTACTGTCTT
GCACATTTGCACAATGAAAACAACCCGTTGCTGCGCCAGTGGGCTTGTCTCTGTCTCAGTCAACTCTGGCAAGAT
CTCGTCGAGGCCAAGTGGCGCGGCATTCGTGAGAATGCCTATGTCAAGCTGGCCTACCTGATGCGCGACCCCTGC
TGCGAGGTGCGGGCTGCCATGATACACGCCATGACATCCTTTATTGGCATTCCAGACTTGACGGACGAAGTTGCT
CGCATCGAGGAATCCATCGCCTGGACTCTGCTTGAAATGGGCAATGATGGAAGTCCCGTGGTGCGCAAAGAGTTT
CTTGTCTTCCTCTCACATTTCGTGCTGCGTTTTGAGAACAAGTTTCTGGTGGCGGCTTTTGAACAGCTGTTGGAG
GAAAAGGAGCACCTCGTGTCACCAAGTGCGGACGACAGCCACGACTACAAAACGGGCCTGCACAACGCCAAGTCT
AGCAATAGGAACAAGGACGCCGCTGTCAAGGCCATGAGTCACGGGCTGTCGCAGCATACAGTCTACATGGCGTGT
TGGAAGCACGCTCTGATTCTCAGCGTTGATCCTCACCCCGAGGTACGGCGAGAGGCGACAATCATGGTGGACTAT
GTGCACAGCACCCTCTTGAAATCGAGTGTCAAGGAGGCCGCACAGGCTCTCATGCGGGATCTTCAGCGGCGATCG
CAAAAGGCGGCGTCGGTTAGGCAGGCAGCTTACACTGTACAGCGCAATGGTGTACGAGGCACCCCAAACGTCGCT
CCACCTCCGTCCCCCGGCCTCTTGCGGCGGACGGCCAGTCTCCTGTTTCCTTCATTTGCCGGCCTCGAAGACAAG
CCCAAGTCCAACTCGCAGCCGCATGCCATGCTGGTCAAGTCGGCGTCGGTCAAGATGTCTGCAGACCAAGTCTCG
GCGCCACCCGAGCAGACTGACCAGCCCAAGGCGCTGGCGGCATATGGTGTGGCGCCTGAGCCGGCGTCGGGGGCA
TATCAAAAACGCAACCTTGACATTGCGCCTTTTTTGCCGCTCAGGAGCCAGTTTCTAGAGTGGTCTATTGAGTAC
TTTCGAGAGCCGCAGATGAAGGCTAGCGAGGCTGATGAGCCGGGAAGCACCGACTACAATGCCCGGCTTTGGCGG
CGGGCGCGCAACGAAGCAGTGCTGCGCGAGACACAGCCACTAAAGCAGCATGCCGGCAGTCACAAGTGGAACAAC
CAGCTAGGTCTCATCAACAACGGAGCGCAACCAGCAAAGATGGCTTTTCATCAGTACGAAGACCACCTGGCCGTG
TGCGACGACGGCAACACGGTGTGCATCTGGGATTGGAAGAAGCAGGGCCGCCTCAACCGCTTCAGCAACGGAAAC
CCCGAGGGCTCCAAGATCAGCGACATCAAGTACATCAATGAGGACGACCAGGCCCTTCTCATGACGGGTTCGTCG
GACGGCGTGATGCGCGTTTACCGAGACTACGATTGCGAGGACATGCAGCTAGCAACGTCGTGGCGAGCCCTGACG
CACATGGTTCCCAGCAACGTCAACTCGGGCATGGTGTTTGACTGGCAGCAGGTGACGGGCCGCGTCTTGGTGGCA
GGCGATGTGCGCGTGATTCGCGTGTGGTACGCGGCACACGAGACGTGCATCATGGACATTCCTGCTAGATCGGGA
TCGTGCGTGACGTCGCTGACGTCGGACCAGATGACGGGCAACATGTTTGTTGCTGGCTTTGGCGATGGTGCGGTG
CGCGTCTTTGACACGCGGCAACGCCCGCAGGATTCAATGGTGCGCAAGTGGAAGGATGACTCGGACCGGCAGTGG
ATCAAGAGCGTGCACATGCAGCGCGGCGGGCAGCGAGAGCTCCTGAGCGCCAGTCGCAACGGCAAGGTCAAGGTG
TGGGATGTGCGCATGGACGAGCCGTTGCATGTTTTTGGCACCACGCGCGACACGCTGCGCACCATGAGCACCCAT
GAACACTTGCCCGTCTTTGCTGTAGGAACTTCCCAGCACACGGTCAAGGTGTTTAATCTCGACGGCAACGAGCTC
TCACGCCTGGAGCCATACTCGAGCTTCCTGCATCAGACGCGCGGAGGCGTTATATCGACCACGGCCTTCCACCCA
CACCGGCCCGTGCTGGGCTGCGCAGCGCGAGGCGACCAGCACATAAACCTGTATACTTGCGAGAGGACGGAGCCT
CTGCACCTGGATTAG
Gene >OphauG2|1673
ATGACTGTCGTACCAGGCCAGCGCCAGCACCAACAGCAGCAGCCATCGCAGACGGCGCCGTCTCCACTCCACCAG
CCCCGTCTTGTCGATGCAGCTCCTTCGGCCACTGCCAAGCACCCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCC
GTGGTGTCGTCGTCGACGTCGTCGTCTGAGCCGACTCTGCTTGGGCCAGCCTTGTCGCGCACGCGCCCAGCCCTC
CCCCGACAACTGCTCCATGGACCTCAGCAGCCTGCAGACATGACGCTGCGACACGACTTGCGCCGCGGCTCGCTG
CCCACCACGCCCAGACCCGACTCCCACACCGACAGCAGCTCCGACCAGCACTCGCAGCCCATGCGGCCGCTGCCT
ACTCCCGCCTACCGCCGCCGGCCCTTGACCGCTGCCGGCCTCCAGCTCCATGGCCAGGACACGCTGCCTGCTGAG
AATGGCTGCCTGCAAGACGCTGGCGACGCCCTGTCAGATTGGCCGGCCCCTGCACCACAGCCCCCCGCCGTCGAC
GACTCCCTGGCACGCCTCAAGAAGCCCCAGCTGCTGCGCTCCAAAAGCGACTTCATCGACTACGATGCTGCTCCA
GACCAGGAGCCCCAATTGCGCGAGTGGGGAGCCCGCCATGGCTTTGACGGCCACTATCAATCCGAGCATGTAATC
TCTGAACTCGTCAACGTATGTCGTTCCTTCCTCAAGCCCTCTGTGCCCTTGCGTGCCTTTGCTCGTGCCTTGATG
GTGCCTTGATGGTGCCTCGATGGCATCAAGTGCTCCGCCCATTCACACCTCACCACCATTCCACCTCTGTTCCAC
CTCTGTTCCACCTCTGTCCTTGTTGCTCGCTCCTTGCAATCAGCCCGGCCGCCCGCCTGCCAATCGTTGGGGCCC
TCGTCAACCCACTCCCTTGCTGCCTCGCGTCGTCTGTCCGCCCCAATTGCACTGGCACTATGAAGCCCTAGGCGG
ACTTGATAGCCCAGTCTAAACTATCCATCGGCCCATGGCCCCAAGCAGAGCCACCAAAGAGGCAGAGACGCGCTG
ACTCGACGGTCCAGAACTGGTACATGTACTATACCGATAAACGCCACGAGACAACAGGCAAGCCCAAGCCTCTCA
AATATGAGCTGCAGGACTGGCGCCAACGCGATCGTCTCAAGACCATCTCGGCTGCCCTGGCCGTCTGTCTCAACA
TTGGCGTGGAGCCTCCAGATCAGCTCAAGACAACTCCCGGCGCAAAGCTCGAGGCCTGGACAGACCCCACTGTTC
CACCTGTGCAAAAGGCACTCGACAACATTGGCAAGGCTCTGCAGTCGCAGTACGAGACGCTAGCCATTCGAGCCC
GCTACAAGCAGTACCTAGATCCAACATTTGAAGAGACCAAAAAGTTTTGCGTCTCGCTACGCCGCAACGCCAAAG
ACGAGCGCGTTCTCTTGCATTACAATGGCCACGGCGTTCCAAAGCCCACCGTGTCGGGCGAGATATGGGTCTTCA
ACAAGACGTACACACAGTATATTCCCGTCAGCCTCTACGATTTGCAAAATTGGCTGCAGGCCCCAACCATTTTTG
TCTGGGACTGCTCAGAGGCAGGCAACATACTCAATAATTACCACCGCTTCGTGGACAAGCACGACGACGAGGAGA
ATGAGGCTGCCGAGAGAGATGCGCATTACGAAAAGACTAATTTTCGCCCCTATATCCATCTAGCCGCCTGCGCCG
TCAAGGAAAACCTGCCCACCAATCCCCTGCTGCCAGCCGACCTCTTCACGGCTTGTCTCACCACCCCTATTGAAA
TGGCTCTCTGGTTCTTTGTCCTGCAGAATCCCCTAAAGACCAACTTGACCCCGGAGCGAGCCAAGCAGCTGCCTG
GCCGGCTTCAGGAGCGTCGCACGCCACTTGGCGAGCTCAACTGGATCTTTACCGCCATTACGGACAGCATCGCCT
GGACCACTTTGCCCCGCGATTTGTTTCGCAAGTTTTTCCGCCAGGACCTCATGGTGGCGGCTCTCTTTCGCAATT
TTCTTCTCGCGCAGCGCGTCATGGCTGTCTACGGCTGCCATCCACAGTCGTATCCTGCTCTTCCCGATACGCACC
AGCACCCCCTCTGGGCAACCTGGGACTTGGCAGTTGACATGGCGCTGGCTCAGCTTCCCATGATGGAGAGCAAGG
AGGGCGAGGGCGTCGACTACGAATACCAGAATTCAACCTTCTTCACCGAGCAGCTTACGGCTTTTGATGTTTACC
TCACCCGAGGCGATGCCATGGAGCAGAAGCCCCCCGACCAGCTCCCCGTCGTGCTGCAGGTGTTGCTAAGCCAGC
AGCATAGAGTGCGCGCCCTAATTCTGCTCGGCAGGTTCCTCGACCTCGGCCCATGGTCCGTTCAGCTAGCCCTCA
GCATCGGCATCTTTCCATATGTCCTCAAACTACTGCAATCTGCTGCGTCAGAGCTCAAGCCTGTCATGGTGTACA
TTTGGGCCAGACTCATTGCTGTCGACATTTCGTGTCAGCAAGATCTCATCAAGGATAATGGCTATAGCTACTTTG
CGCAGATTCTCAAGCCCTCCGAGGGCCTTCCGGTTGTCGACAGCGACGAACACAAGGCCATGTGCGCCTTTATTC
TTGCCATGCTTTGCAAGGACTATCGAAACGGCCAGGTTGTGTGCAACCAGACAGACGTCATGTCGTACTGTCTTG
CACATTTGCACAATGAAAACAACCCGTTGCTGCGCCAGTGGGCTTGTCTCTGTCTCAGTCAACTCTGGCAAGATC
TCGTCGAGGCCAAGTGGCGCGGCATTCGTGAGAATGCCTATGTCAAGCTGGCCTACCTGATGCGCGACCCCTGCT
GCGAGGTGCGGGCTGCCATGATACACGCCATGACATCCTTTATTGGCATTCCAGACTTGACGGACGAAGTTGCTC
GCATCGAGGAATCCATCGCCTGGACTCTGCTTGAAATGGGCAATGATGGAAGTCCCGTGGTGCGCAAAGAGTTTC
TTGTCTTCCTCTCACATTTCGTGCTGCGTTTTGAGAACAAGTTTCTGGTGGCGGCTTTTGAACAGCTGTTGGAGG
AAAAGGAGCACCTCGTGTCACCAAGTGCGGACGACAGCCACGACTACAAAACGGGCCTGCACAACGCCAAGTCTA
GCAATAGGAACAAGGACGCCGCTGTCAAGGCCATGAGTCACGGGCTGTCGCAGCATACAGTCTACATGGCGTGTT
GGAAGCACGCTCTGATTCTCAGCGTTGATCCTCACCCCGAGGTACGGCGAGAGGCGACAATCATGGTGGACTATG
TGCACAGCACCCTCTTGAAATCGAGTGTCAAGGAGGCCGCACAGGCTCTCATGCGGGATCTTCAGCGGCGATCGC
AAAAGGCGGCGTCGGTTAGGCAGGCAGCTTACACTGTACAGCGCAATGGTGTACGAGGCACCCCAAACGTCGCTC
CACCTCCGTCCCCCGGCCTCTTGCGGCGGACGGCCAGTCTCCTGTTTCCTTCATTTGCCGGCCTCGAAGACAAGC
CCAAGTCCAACTCGCAGCCGCATGCCATGCTGGTCAAGTCGGCGTCGGTCAAGATGTCTGCAGACCAAGTCTCGG
CGCCACCCGAGCAGACTGACCAGCCCAAGGCGCTGGCGGCATATGGTGTGGCGCCTGAGCCGGCGTCGGGGGCAT
ATCAAAAACGCAACCTTGACATTGCGCCTTTTTTGCCGCTCAGGAGCCAGTTTCTAGAGTGGTCTATTGAGTACT
TTCGAGAGCCGCAGATGAAGGCTAGCGAGGCTGATGAGCCGGGAAGCACCGACTACAATGCCCGGCTTTGGCGGC
GGGCGCGCAACGAAGCAGTGCTGCGCGAGACACAGCCACTAAAGCAGCATGCCGGCAGTCACAAGTGGAACAACC
AGCTAGGTCTCATCAACAACGGAGCGCAACCAGCAAAGATGGCTTTTCATCAGTACGAAGACCACCTGGCCGTGT
GCGACGACGGCAACACGGTGTGCATCTGGGATTGGAAGAAGCAGGGCCGCCTCAACCGCTTCAGCAACGGAAACC
CCGAGGGCTCCAAGATCAGCGACATCAAGTACATCAATGAGGACGACCAGGCCCTTCTCATGACGGGTTCGTCGG
ACGGCGTGATGCGCGTTTACCGAGACTACGATTGCGAGGACATGCAGCTAGCAACGTCGTGGCGAGCCCTGACGC
ACATGGTTCCCAGCAACGTCAACTCGGGCATGGTGTTTGACTGGCAGCAGGTGACGGGCCGCGTCTTGGTGGCAG
GCGATGTGCGCGTGATTCGCGTGTGGTACGCGGCACACGAGACGTGCATCATGGACATTCCTGCTAGATCGGGAT
CGTGCGTGACGTCGCTGACGTCGGACCAGATGACGGGCAACATGTTTGTTGCTGGCTTTGGCGATGGTGCGGTGC
GCGTCTTTGACACGCGGCAACGCCCGCAGGATTCAATGGTGCGCAAGTGGAAGGATGACTCGGACCGGCAGTGGA
TCAAGAGCGTGCACATGCAGCGCGGCGGGCAGCGAGAGCTCCTGAGCGCCAGTCGCAACGGCAAGGTCAAGGTGT
GGGATGTGCGCATGGACGAGCCGTTGCATGTTTTTGGCACCACGCGCGACACGCTGCGCACCATGAGCACCCATG
AACACTTGCCCGTCTTTGCTGTGTAAGTCGATGGCCCTGTTTGGTGGCTTGTTTGGAGCCGACTGCTGACGGCAG
CATTCACAGAGGAACTTCCCAGCACACGGTCAAGGTGTTTAATCTCGACGGCAACGAGCTCTCACGCCTGGAGCC
ATACTCGAGCTTCCTGCATCAGACGCGCGGAGGCGTTATATCGACCACGGCCTTCCACCCACACCGGCCCGTGCT
GGGCTGCGCAGCGCGAGGCGACCAGCACATAAACCTGTATACTTGCGAGAGGACGGAGCCTCTGCACCTGGATTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail