Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1662
Gene name
LocationContig_1516:243..800
Strand-
Gene length (bp)557
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 16 125 9.0E-21

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup339
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1109
Ophiocordyceps australis 1348a (Ghana) OphauG2|1662 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|588
Ophiocordyceps australis map64 (Brazil) OphauB2|6448
Ophiocordyceps camponoti-floridani Ophcf2|06233
Ophiocordyceps camponoti-rufipedis Ophun1|1945
Ophiocordyceps camponoti-rufipedis Ophun1|4166
Ophiocordyceps kimflemingae Ophio5|2110
Ophiocordyceps subramaniannii Hirsu2|4346
Ophiocordyceps subramaniannii Hirsu2|7114

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1662
MHANTDFLAAGGPNGYAWNLIRSESDELLLKHAETSGAKVFQTTKVEAIQFETTLPLDSHATVSSTDRPISASWA
CRDGTAGNISFEYLIDASGRHGILSTKYLKNRTVNDNFKNIANWGYWSGCEMYGQGTHMDSAPYFEALQGIHFFP
VQASIASPMVTDSRHN*
Coding >OphauG2|1662
ATGCATGCAAACACGGATTTCCTTGCCGCAGGCGGTCCCAACGGATATGCCTGGAACCTGATTCGATCCGAGTCT
GACGAGTTGCTTCTCAAGCATGCGGAAACGAGCGGCGCCAAAGTCTTCCAAACAACAAAAGTCGAAGCTATTCAA
TTCGAAACGACTCTGCCGCTTGACAGCCATGCCACCGTGTCCAGCACTGACCGTCCCATATCAGCTTCCTGGGCC
TGCAGAGACGGCACTGCAGGCAATATTTCATTCGAGTACCTCATTGACGCCAGCGGCAGACACGGCATTCTGAGC
ACCAAGTATCTCAAGAATCGCACAGTCAACGACAACTTTAAGAATATTGCAAACTGGGGCTACTGGTCTGGCTGT
GAAATGTACGGCCAGGGTACACACATGGACAGCGCTCCGTACTTTGAAGCCTTGCAAGGTATTCACTTTTTCCCA
GTCCAAGCATCCATCGCCTCGCCCATGGTGACTGACTCGAGACACAACTAG
Transcript >OphauG2|1662
ATGCATGCAAACACGGATTTCCTTGCCGCAGGCGGTCCCAACGGATATGCCTGGAACCTGATTCGATCCGAGTCT
GACGAGTTGCTTCTCAAGCATGCGGAAACGAGCGGCGCCAAAGTCTTCCAAACAACAAAAGTCGAAGCTATTCAA
TTCGAAACGACTCTGCCGCTTGACAGCCATGCCACCGTGTCCAGCACTGACCGTCCCATATCAGCTTCCTGGGCC
TGCAGAGACGGCACTGCAGGCAATATTTCATTCGAGTACCTCATTGACGCCAGCGGCAGACACGGCATTCTGAGC
ACCAAGTATCTCAAGAATCGCACAGTCAACGACAACTTTAAGAATATTGCAAACTGGGGCTACTGGTCTGGCTGT
GAAATGTACGGCCAGGGTACACACATGGACAGCGCTCCGTACTTTGAAGCCTTGCAAGGTATTCACTTTTTCCCA
GTCCAAGCATCCATCGCCTCGCCCATGGTGACTGACTCGAGACACAACTAG
Gene >OphauG2|1662
ATGCATGCAAGTCCACGATCTTGCTCCATACTACAAGGAAGAAAAGAAAGACTGACGTTTATCCAGACACGGATT
TCCTTGCCGCAGGCGGTCCCAACGGATATGCCTGGAACCTGATTCGATCCGAGTCTGACGAGTTGCTTCTCAAGC
ATGCGGAAACGAGCGGCGCCAAAGTCTTCCAAACAACAAAAGTCGAAGCTATTCAATTCGAAACGACTCTGCCGC
TTGACAGCCATGCCACCGTGTCCAGCACTGACCGTCCCATATCAGCTTCCTGGGCCTGCAGAGACGGCACTGCAG
GCAATATTTCATTCGAGTACCTCATTGACGCCAGCGGCAGACACGGCATTCTGAGCACCAAGTATCTCAAGAATC
GCACAGTCAACGACAACTTTAAGAATATTGCAAACTGGGGCTACTGGTCTGGCTGTGAAATGTACGGCCAGGGTA
CACACATGGACAGCGCTCCGTACTTTGAAGCCTTGCAAGGTATTCACTTTTTCCCAGTCCAAGCATCCATCGCCT
CGCCCATGGTGACTGACTCGAGACACAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail