Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1649
Gene name
LocationContig_151:19257..20000
Strand-
Gene length (bp)743
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 1.2E-11 149 214
PF13833 EF-hand_8 EF-hand domain pair 9.7E-09 163 215
PF13202 EF-hand_5 EF hand 3.6E-04 153 173

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 36 216 1.0E-20
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 56 216 1.0E-20
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 58 216 4.0E-20
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 29 216 8.0E-20
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 33 216 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 36 216 1.0E-20
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 56 216 1.0E-20
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 58 216 4.0E-20
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 29 216 8.0E-20
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 33 216 1.0E-19
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 58 213 2.0E-19
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 58 217 3.0E-19
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 58 213 3.0E-19
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 58 213 3.0E-19
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 58 213 3.0E-19
sp|P06704|CDC31_YEAST Cell division control protein 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC31 PE=1 SV=2 56 212 5.0E-19
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 58 216 6.0E-19
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 32 216 1.0E-18
sp|Q24956|CATR_GIAIN Caltractin OS=Giardia intestinalis GN=CAL PE=3 SV=1 56 213 2.0E-18
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 32 216 3.0E-17
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 56 216 1.0E-16
sp|O74435|CDC31_SCHPO Cell division control protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc31 PE=1 SV=1 58 216 2.0E-16
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 57 213 6.0E-16
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 57 217 9.0E-16
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 45 214 4.0E-15
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 58 216 4.0E-15
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 57 214 3.0E-14
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 57 213 2.0E-13
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 57 213 2.0E-13
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 57 213 2.0E-13
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 57 213 2.0E-13
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 57 213 4.0E-13
sp|Q338P8|CML8_ORYSJ Probable calcium-binding protein CML8 OS=Oryza sativa subsp. japonica GN=CML8 PE=2 SV=1 58 217 6.0E-13
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 57 213 8.0E-13
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 65 213 2.0E-12
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 58 213 3.0E-12
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 58 213 3.0E-12
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 58 213 6.0E-12
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 58 213 7.0E-12
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 58 213 7.0E-12
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 57 213 8.0E-12
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 58 213 8.0E-12
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 58 213 8.0E-12
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 58 213 8.0E-12
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 58 213 8.0E-12
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 58 213 8.0E-12
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 58 213 8.0E-12
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 58 213 8.0E-12
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 58 213 8.0E-12
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 58 213 8.0E-12
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 58 213 8.0E-12
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 58 213 8.0E-12
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 58 213 8.0E-12
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 58 213 8.0E-12
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 58 213 8.0E-12
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 58 213 8.0E-12
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 58 213 8.0E-12
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 58 213 1.0E-11
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 58 213 1.0E-11
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 58 213 1.0E-11
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 58 213 1.0E-11
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 58 213 1.0E-11
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 58 213 1.0E-11
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 58 213 1.0E-11
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 58 213 1.0E-11
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 58 213 2.0E-11
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 58 213 2.0E-11
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 58 213 2.0E-11
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 58 213 2.0E-11
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 58 213 2.0E-11
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 58 213 2.0E-11
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 58 213 3.0E-11
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 58 215 3.0E-11
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 58 213 3.0E-11
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 57 213 3.0E-11
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 58 213 3.0E-11
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 58 213 3.0E-11
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 58 213 3.0E-11
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 58 213 3.0E-11
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 58 213 3.0E-11
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 58 213 3.0E-11
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 58 213 3.0E-11
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 58 213 3.0E-11
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 58 213 3.0E-11
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 58 213 3.0E-11
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 58 213 3.0E-11
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 58 213 3.0E-11
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 58 213 4.0E-11
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 58 213 4.0E-11
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 58 213 4.0E-11
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 58 213 4.0E-11
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 58 213 4.0E-11
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 58 213 5.0E-11
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 58 213 6.0E-11
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 68 213 7.0E-11
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 58 213 9.0E-11
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 58 213 1.0E-10
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 58 213 1.0E-10
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 57 213 1.0E-10
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 57 213 1.0E-10
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 57 213 1.0E-10
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 57 213 1.0E-10
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 57 213 1.0E-10
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 58 213 2.0E-10
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 58 213 2.0E-10
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 58 213 2.0E-10
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 57 213 2.0E-10
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 57 213 2.0E-10
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 57 213 2.0E-10
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 58 213 3.0E-10
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 58 213 3.0E-10
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 58 213 3.0E-10
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 58 213 3.0E-10
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 58 213 5.0E-10
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 58 213 5.0E-10
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 125 213 5.0E-10
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 58 213 6.0E-10
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 58 213 6.0E-10
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 58 213 6.0E-10
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 58 213 6.0E-10
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 58 213 7.0E-10
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 58 213 9.0E-10
sp|P15159|TNNC_TACTR Troponin C OS=Tachypleus tridentatus PE=1 SV=1 70 213 9.0E-10
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 136 213 1.0E-09
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 58 213 1.0E-09
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 58 213 1.0E-09
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 68 213 2.0E-09
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 58 213 2.0E-09
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 58 213 2.0E-09
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 58 213 2.0E-09
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 58 213 2.0E-09
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 58 209 2.0E-09
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 58 213 2.0E-09
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 68 210 3.0E-09
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 58 213 3.0E-09
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 58 213 3.0E-09
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 58 213 3.0E-09
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 58 213 3.0E-09
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 58 213 3.0E-09
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 58 213 3.0E-09
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 58 213 3.0E-09
sp|Q0JC44|CML22_ORYSJ Probable calcium-binding protein CML22 OS=Oryza sativa subsp. japonica GN=CML22 PE=3 SV=1 62 217 3.0E-09
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 58 213 3.0E-09
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 58 213 4.0E-09
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 58 213 4.0E-09
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 125 213 4.0E-09
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 58 213 4.0E-09
sp|P04573|CAVP_BRALA Calcium vector protein OS=Branchiostoma lanceolatum PE=1 SV=3 57 216 5.0E-09
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 58 213 5.0E-09
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 58 213 5.0E-09
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 58 213 5.0E-09
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 58 213 5.0E-09
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 134 213 5.0E-09
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 68 213 6.0E-09
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 58 213 7.0E-09
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 58 213 8.0E-09
sp|Q3SEK0|CATR5_PARTE Caltractin ICL1e OS=Paramecium tetraurelia GN=Icl1e PE=3 SV=1 25 213 1.0E-08
sp|P21797|TNNC1_BALNU Troponin C, isoform 1 OS=Balanus nubilus PE=1 SV=1 70 213 1.0E-08
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 149 213 1.0E-08
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 58 217 1.0E-08
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 134 213 2.0E-08
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 58 213 2.0E-08
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 58 213 2.0E-08
sp|O01305|CAVP_BRAFL Calcium vector protein OS=Branchiostoma floridae PE=2 SV=3 57 216 3.0E-08
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 68 209 3.0E-08
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 70 213 5.0E-08
sp|O22845|CML5_ARATH Calmodulin-like protein 5 OS=Arabidopsis thaliana GN=CML5 PE=2 SV=2 69 217 7.0E-08
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 65 217 8.0E-08
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 50 213 9.0E-08
sp|Q9ZQE6|CML1_ARATH Calmodulin-like protein 1 OS=Arabidopsis thaliana GN=CML1 PE=2 SV=1 64 213 1.0E-07
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 58 213 2.0E-07
sp|P47949|TNNC3_DROME Troponin C, isoform 3 OS=Drosophila melanogaster GN=TpnC73F PE=2 SV=2 134 213 2.0E-07
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 91 216 2.0E-07
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 134 213 3.0E-07
sp|Q9LX27|CML4_ARATH Calmodulin-like protein 4 OS=Arabidopsis thaliana GN=CML4 PE=2 SV=1 69 216 3.0E-07
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 58 214 3.0E-07
sp|Q568G4|EFC11_DANRE EF-hand calcium-binding domain-containing protein 11 OS=Danio rerio GN=efcab11 PE=2 SV=1 58 213 3.0E-07
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 57 213 4.0E-07
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 68 213 4.0E-07
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 58 213 4.0E-07
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 68 213 4.0E-07
sp|Q7Z2B8|MLCD_DICDI Myosin-ID light chain OS=Dictyostelium discoideum GN=mlcD PE=1 SV=1 56 213 4.0E-07
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 68 213 5.0E-07
sp|Q9BLG0|TNNC_TODPA Troponin C OS=Todarodes pacificus PE=1 SV=3 68 213 5.0E-07
sp|P06708|TNNC2_ASTLP Troponin C, isotype gamma OS=Astacus leptodactylus PE=1 SV=1 138 213 6.0E-07
sp|P29289|TNNC1_HOMAM Troponin C, isoform 1 OS=Homarus americanus PE=1 SV=1 134 213 6.0E-07
sp|P29291|TNNCB_HOMAM Troponin C, isoform 2B OS=Homarus americanus PE=1 SV=1 138 213 8.0E-07
sp|P47948|TNNC2_DROME Troponin C, isoform 2 OS=Drosophila melanogaster GN=TpnC47D PE=2 SV=2 134 213 8.0E-07
sp|Q9SU00|CML2_ARATH Calmodulin-like protein 2 OS=Arabidopsis thaliana GN=CML2 PE=2 SV=1 62 217 8.0E-07
sp|P29290|TNNCA_HOMAM Troponin C, isoform 2A OS=Homarus americanus PE=1 SV=1 138 213 8.0E-07
sp|Q9ZR02|CML6_ARATH Calmodulin-like protein 6 OS=Arabidopsis thaliana GN=CML6 PE=2 SV=1 62 216 1.0E-06
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 58 217 1.0E-06
sp|Q54IY3|CETNA_DICDI Centrin-A OS=Dictyostelium discoideum GN=cenA PE=3 SV=1 58 213 1.0E-06
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 31 216 2.0E-06
sp|Q9SRR7|CML3_ARATH Calmodulin-like protein 3 OS=Arabidopsis thaliana GN=CML3 PE=2 SV=1 62 217 2.0E-06
sp|Q54X77|CETNB_DICDI Centrin-B OS=Dictyostelium discoideum GN=cenB PE=3 SV=1 64 213 2.0E-06
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 58 213 3.0E-06
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 49 213 4.0E-06
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 58 213 5.0E-06
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 125 213 5.0E-06
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 39 213 7.0E-06
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 58 213 8.0E-06
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 57 217 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1844
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1649 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7040
Ophiocordyceps camponoti-floridani Ophcf2|01155
Ophiocordyceps camponoti-rufipedis Ophun1|75
Ophiocordyceps kimflemingae Ophio5|3082
Ophiocordyceps subramaniannii Hirsu2|1849

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1649
MNSHQTPRPFPSRSIGPSGQSAHQSQQQHQPSHPHTLPQSQQQRSSAPVVLGDEYAALADEDRDHIDEVFDLMDM
KKKGHLNSYEFKHSLAALGFDLPKPEYFRLLEIHGTVPPGWRDPTGCPVNRLLVYPDAFRSCAARLIASRDPREE
AAKVFAMFDYDGDGIISFDDMRHLAHEIKDDRALPDEEIQSMIDHLDHDGKGGVNLDEFMQMMEEAG*
Coding >OphauG2|1649
ATGAACTCACATCAGACGCCGCGTCCCTTTCCCTCGCGGTCAATTGGGCCCTCTGGGCAGAGCGCCCATCAGTCG
CAACAACAGCATCAACCATCGCATCCGCATACACTCCCCCAGAGCCAGCAGCAAAGGTCTTCGGCCCCCGTGGTG
CTGGGCGACGAGTATGCAGCACTGGCAGACGAGGACAGAGATCACATAGACGAAGTATTTGATCTCATGGATATG
AAGAAAAAAGGCCATCTCAACAGCTACGAATTCAAACACTCCCTTGCCGCCCTTGGCTTCGACCTACCCAAACCC
GAATACTTTCGCCTGCTCGAAATTCACGGTACCGTGCCCCCTGGCTGGCGCGATCCTACCGGCTGCCCCGTCAAC
CGTCTTCTTGTTTACCCCGACGCCTTCCGTTCCTGTGCAGCCCGCCTCATTGCCTCGCGCGACCCCCGTGAGGAA
GCGGCAAAAGTTTTTGCAATGTTCGACTACGACGGCGATGGCATCATTTCCTTTGACGACATGCGCCATCTTGCT
CACGAGATCAAAGATGACCGTGCCCTGCCAGACGAAGAAATCCAGAGCATGATTGACCACCTTGACCACGATGGA
AAAGGGGGTGTTAACCTCGACGAGTTTATGCAGATGATGGAAGAGGCTGGGTAG
Transcript >OphauG2|1649
ATGAACTCACATCAGACGCCGCGTCCCTTTCCCTCGCGGTCAATTGGGCCCTCTGGGCAGAGCGCCCATCAGTCG
CAACAACAGCATCAACCATCGCATCCGCATACACTCCCCCAGAGCCAGCAGCAAAGGTCTTCGGCCCCCGTGGTG
CTGGGCGACGAGTATGCAGCACTGGCAGACGAGGACAGAGATCACATAGACGAAGTATTTGATCTCATGGATATG
AAGAAAAAAGGCCATCTCAACAGCTACGAATTCAAACACTCCCTTGCCGCCCTTGGCTTCGACCTACCCAAACCC
GAATACTTTCGCCTGCTCGAAATTCACGGTACCGTGCCCCCTGGCTGGCGCGATCCTACCGGCTGCCCCGTCAAC
CGTCTTCTTGTTTACCCCGACGCCTTCCGTTCCTGTGCAGCCCGCCTCATTGCCTCGCGCGACCCCCGTGAGGAA
GCGGCAAAAGTTTTTGCAATGTTCGACTACGACGGCGATGGCATCATTTCCTTTGACGACATGCGCCATCTTGCT
CACGAGATCAAAGATGACCGTGCCCTGCCAGACGAAGAAATCCAGAGCATGATTGACCACCTTGACCACGATGGA
AAAGGGGGTGTTAACCTCGACGAGTTTATGCAGATGATGGAAGAGGCTGGGTAG
Gene >OphauG2|1649
ATGAACTCACATCAGACGCCGCGTCCCTTTCCCTCGCGGTCAATTGGGCCCTCTGGGCAGAGCGCCCATCAGTCG
CAACAACAGCATCAACCATCGCATCCGCATACACTCCCCCAGAGCCAGCAGCAAAGGTCTTCGGCCCCCGTGGTG
CTGGGCGACGAGTATGCAGCACTGGCAGACGAGGACAGAGATCACATAGACGAAGTAGTAAGTTGCACACCTCGT
TCTCCAGGGGCAAAAAGATGGTAGCAAAGCTCTGGTAGGCGACGAGCAATCGAGGCTGACACGTGACTCAGTTTG
ATCTCATGGATATGAAGAAAAAAGGCCATCTCAACAGCTACGAATTCAAACACTCCCTTGCCGCCCTTGGCTTCG
ACCTACCCAAACCCGAATACTTTCGCCTGCTCGAAATTCACGGTACCGTGCCCCCTGGCTGGCGCGATCCTACCG
GCTGCCCCGTCAACCGTCTTCTTGTTTACCCCGACGCCTTCCGTTCCTGTGCAGCCCGCCTCATTGCCTCGCGCG
ACCCCCGTGAGGAAGCGGCAAAAGTTTTTGCAATGTTCGACTACGACGGCGATGGCATCATTTCCTTTGACGACA
TGCGCCATCTTGCTCACGAGATCAAAGATGACCGTGCCCTGCCAGACGAAGAAATCCAGAGCATGATTGACCACC
TTGACCACGATGGAAAAGGGGGTGTTAACCTCGACGAGTTTATGCAGATGATGGAAGAGGCTGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail