Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1648
Gene name
LocationContig_151:16588..18430
Strand+
Gene length (bp)1842
Transcript length (bp)1662
Coding sequence length (bp)1662
Protein length (aa) 554

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01417 ENTH ENTH domain 9.6E-50 15 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 8 391 7.0E-57
sp|Q12518|ENT1_YEAST Epsin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT1 PE=1 SV=1 1 232 2.0E-50
sp|Q9H201|EPN3_HUMAN Epsin-3 OS=Homo sapiens GN=EPN3 PE=2 SV=1 2 241 6.0E-48
sp|Q9Y6I3|EPN1_HUMAN Epsin-1 OS=Homo sapiens GN=EPN1 PE=1 SV=2 2 233 3.0E-46
sp|Q80VP1|EPN1_MOUSE Epsin-1 OS=Mus musculus GN=Epn1 PE=1 SV=3 2 233 3.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 8 391 7.0E-57
sp|Q12518|ENT1_YEAST Epsin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT1 PE=1 SV=1 1 232 2.0E-50
sp|Q9H201|EPN3_HUMAN Epsin-3 OS=Homo sapiens GN=EPN3 PE=2 SV=1 2 241 6.0E-48
sp|Q9Y6I3|EPN1_HUMAN Epsin-1 OS=Homo sapiens GN=EPN1 PE=1 SV=2 2 233 3.0E-46
sp|Q80VP1|EPN1_MOUSE Epsin-1 OS=Mus musculus GN=Epn1 PE=1 SV=3 2 233 3.0E-46
sp|Q05785|ENT2_YEAST Epsin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT2 PE=1 SV=1 1 224 3.0E-46
sp|O88339|EPN1_RAT Epsin-1 OS=Rattus norvegicus GN=Epn1 PE=1 SV=1 2 233 3.0E-46
sp|O95208|EPN2_HUMAN Epsin-2 OS=Homo sapiens GN=EPN2 PE=1 SV=3 2 153 5.0E-46
sp|Q4V882|EPN3_RAT Epsin-3 OS=Rattus norvegicus GN=Epn3 PE=1 SV=1 2 153 6.0E-46
sp|Q91W69|EPN3_MOUSE Epsin-3 OS=Mus musculus GN=Epn3 PE=1 SV=1 2 153 7.0E-46
sp|Q9Z1Z3|EPN2_RAT Epsin-2 OS=Rattus norvegicus GN=Epn2 PE=1 SV=1 2 143 4.0E-45
sp|Q8CHU3|EPN2_MOUSE Epsin-2 OS=Mus musculus GN=Epn2 PE=1 SV=1 2 143 4.0E-45
sp|Q8IYW4|ENTD1_HUMAN ENTH domain-containing protein 1 OS=Homo sapiens GN=ENTHD1 PE=2 SV=1 6 143 2.0E-36
sp|Q99KN9|EPN4_MOUSE Clathrin interactor 1 OS=Mus musculus GN=Clint1 PE=1 SV=2 10 143 3.0E-31
sp|A7Z035|EPN4_BOVIN Clathrin interactor 1 OS=Bos taurus GN=CLINT1 PE=2 SV=1 3 143 3.0E-31
sp|Q14677|EPN4_HUMAN Clathrin interactor 1 OS=Homo sapiens GN=CLINT1 PE=1 SV=1 10 143 4.0E-31
sp|Q67YI9|EPN2_ARATH Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana GN=EPSIN2 PE=1 SV=1 21 234 5.0E-31
sp|P47160|ENT3_YEAST Epsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT3 PE=1 SV=1 3 147 1.0E-30
sp|P78813|YCTB_SCHPO ENTH domain-containing protein C794.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.11c PE=1 SV=2 1 170 1.0E-29
sp|Q54EH1|EPN_DICDI Epsin OS=Dictyostelium discoideum GN=epnA PE=3 SV=1 21 143 4.0E-29
sp|Q93YP4|EPN3_ARATH Clathrin interactor EPSIN 3 OS=Arabidopsis thaliana GN=EPSIN3 PE=2 SV=1 21 234 1.0E-28
sp|Q8VY07|EPN1_ARATH Clathrin interactor EPSIN 1 OS=Arabidopsis thaliana GN=EPSIN1 PE=1 SV=1 21 143 1.0E-23
sp|Q12518|ENT1_YEAST Epsin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT1 PE=1 SV=1 438 510 1.0E-17
sp|O74423|ENT1_SCHPO Epsin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ent1 PE=1 SV=1 253 505 1.0E-13
sp|Q07872|ENT4_YEAST Epsin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENT4 PE=1 SV=1 16 112 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1845
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1648 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7041
Ophiocordyceps camponoti-floridani Ophcf2|01156
Ophiocordyceps camponoti-rufipedis Ophun1|74
Ophiocordyceps kimflemingae Ophio5|3083
Ophiocordyceps subramaniannii Hirsu2|1850

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1648
MSKVMRSVKNVTKGYSSTQVKVREATSNDPWGPTGTQMSEIAQMTFNTSTEFYDIMDMLDKRLNDKGKNWRHVLK
ALKVLDYCLHEGSELVVTWARQSIYIIKTLREFQYIDEEGRDVGQNVRVTAKELTSLILDEERLRAERSDRRMWK
SRVLEDYASQFPIAEPSQLPRPRRERRPMDDEEDTEYRLAIEASKHQEEEDRRKRESRDNDNDDDDLAKAIKLSR
EEEERRRRELEQSNAPSLFDDEPVQNTQSQYTGFNQGYQQGNPVDFFANPIDQSQMQTQPTGYMNNAYTGYQQTQ
PTGFQPGYNPAFGMQTGMGMGMNMDQYAPQAFQPQPTGYNPYAQQQLRMQSPPAGEAALQPGSNNPWASNKTQQQ
FLKPTPTGSNNPFAQPTINRPQSAKPASSSLSPLPEQNAMPSFNLSRPQQQQQTAFNTPPKNNLTEYQSKLNSLL
ATGDGQDTFGNTGDVRIPAQHTAPGTFANSAGSGVQRINAEPTGNNPFMRQQFTGMPSISYGGQASNPGLSFGGH
GPGNNPFGAQPQQQQQQQPSQNQDLIQL*
Coding >OphauG2|1648
ATGTCCAAGGTAATGCGAAGCGTCAAAAATGTGACCAAGGGTTACTCAAGCACCCAGGTCAAGGTGAGGGAAGCA
ACAAGTAACGATCCATGGGGTCCCACGGGGACTCAGATGAGCGAAATCGCGCAAATGACTTTTAATACCTCAACT
GAATTTTACGATATCATGGATATGCTTGACAAGCGACTCAACGACAAGGGAAAGAACTGGCGGCATGTTCTCAAG
GCCCTCAAGGTGCTTGATTACTGCCTGCACGAGGGTTCCGAGTTGGTTGTTACTTGGGCTCGACAAAGCATTTAC
ATCATCAAGACCCTGCGCGAGTTTCAATACATCGATGAGGAGGGCCGCGACGTAGGACAGAATGTTCGAGTCACA
GCCAAGGAGCTTACATCTCTAATCCTCGATGAAGAGCGGCTTCGAGCTGAGCGTAGTGACAGGAGGATGTGGAAA
TCCCGAGTCCTGGAAGACTATGCGTCCCAGTTCCCCATCGCAGAGCCTTCTCAGCTGCCACGGCCGCGCCGTGAA
AGGCGGCCCATGGACGATGAAGAAGATACTGAATACCGACTGGCCATTGAGGCTAGCAAGCACCAAGAGGAGGAG
GACAGGAGAAAGAGAGAAAGTCGAGACAACGACAATGATGATGACGACCTGGCAAAGGCAATCAAGCTAAGCAGA
GAGGAGGAAGAGAGGCGGCGTCGTGAGCTCGAACAGAGCAATGCACCCTCTCTTTTCGACGACGAGCCCGTGCAG
AATACTCAATCTCAGTACACCGGCTTCAATCAGGGATACCAACAAGGGAACCCCGTCGACTTTTTTGCGAATCCC
ATTGACCAAAGCCAGATGCAGACGCAGCCAACCGGGTATATGAACAATGCCTACACCGGCTACCAGCAAACCCAG
CCTACAGGCTTTCAGCCGGGCTACAACCCAGCTTTTGGCATGCAAACTGGCATGGGAATGGGCATGAACATGGAT
CAGTATGCACCACAGGCTTTCCAGCCCCAACCCACCGGCTATAATCCGTATGCGCAGCAACAGCTTCGAATGCAG
TCTCCGCCCGCAGGCGAAGCCGCACTGCAGCCAGGAAGTAATAATCCTTGGGCCAGCAATAAAACACAGCAGCAA
TTCTTGAAGCCAACGCCTACCGGCTCCAACAATCCCTTCGCCCAGCCCACCATCAACCGGCCCCAGTCGGCCAAG
CCGGCCTCTTCGTCGTTGAGTCCGCTCCCGGAGCAGAATGCCATGCCATCCTTCAACCTTTCGCGGCCTCAGCAA
CAGCAGCAGACAGCTTTCAACACTCCGCCAAAAAATAACCTGACCGAATACCAGTCCAAGCTCAACTCTCTGCTT
GCCACAGGCGATGGTCAGGATACATTTGGTAATACTGGCGATGTCCGCATCCCTGCTCAACACACGGCTCCTGGA
ACGTTTGCCAATAGCGCCGGGTCAGGCGTACAACGAATCAACGCTGAGCCTACGGGAAATAATCCCTTTATGCGG
CAGCAGTTTACAGGAATGCCCAGCATCAGCTACGGCGGCCAAGCTTCAAATCCTGGTCTCTCTTTTGGCGGCCAC
GGTCCGGGGAACAACCCCTTTGGTGCTCAACCGCAGCAGCAGCAGCAGCAGCAGCCATCACAGAACCAAGATCTG
ATTCAACTCTAA
Transcript >OphauG2|1648
ATGTCCAAGGTAATGCGAAGCGTCAAAAATGTGACCAAGGGTTACTCAAGCACCCAGGTCAAGGTGAGGGAAGCA
ACAAGTAACGATCCATGGGGTCCCACGGGGACTCAGATGAGCGAAATCGCGCAAATGACTTTTAATACCTCAACT
GAATTTTACGATATCATGGATATGCTTGACAAGCGACTCAACGACAAGGGAAAGAACTGGCGGCATGTTCTCAAG
GCCCTCAAGGTGCTTGATTACTGCCTGCACGAGGGTTCCGAGTTGGTTGTTACTTGGGCTCGACAAAGCATTTAC
ATCATCAAGACCCTGCGCGAGTTTCAATACATCGATGAGGAGGGCCGCGACGTAGGACAGAATGTTCGAGTCACA
GCCAAGGAGCTTACATCTCTAATCCTCGATGAAGAGCGGCTTCGAGCTGAGCGTAGTGACAGGAGGATGTGGAAA
TCCCGAGTCCTGGAAGACTATGCGTCCCAGTTCCCCATCGCAGAGCCTTCTCAGCTGCCACGGCCGCGCCGTGAA
AGGCGGCCCATGGACGATGAAGAAGATACTGAATACCGACTGGCCATTGAGGCTAGCAAGCACCAAGAGGAGGAG
GACAGGAGAAAGAGAGAAAGTCGAGACAACGACAATGATGATGACGACCTGGCAAAGGCAATCAAGCTAAGCAGA
GAGGAGGAAGAGAGGCGGCGTCGTGAGCTCGAACAGAGCAATGCACCCTCTCTTTTCGACGACGAGCCCGTGCAG
AATACTCAATCTCAGTACACCGGCTTCAATCAGGGATACCAACAAGGGAACCCCGTCGACTTTTTTGCGAATCCC
ATTGACCAAAGCCAGATGCAGACGCAGCCAACCGGGTATATGAACAATGCCTACACCGGCTACCAGCAAACCCAG
CCTACAGGCTTTCAGCCGGGCTACAACCCAGCTTTTGGCATGCAAACTGGCATGGGAATGGGCATGAACATGGAT
CAGTATGCACCACAGGCTTTCCAGCCCCAACCCACCGGCTATAATCCGTATGCGCAGCAACAGCTTCGAATGCAG
TCTCCGCCCGCAGGCGAAGCCGCACTGCAGCCAGGAAGTAATAATCCTTGGGCCAGCAATAAAACACAGCAGCAA
TTCTTGAAGCCAACGCCTACCGGCTCCAACAATCCCTTCGCCCAGCCCACCATCAACCGGCCCCAGTCGGCCAAG
CCGGCCTCTTCGTCGTTGAGTCCGCTCCCGGAGCAGAATGCCATGCCATCCTTCAACCTTTCGCGGCCTCAGCAA
CAGCAGCAGACAGCTTTCAACACTCCGCCAAAAAATAACCTGACCGAATACCAGTCCAAGCTCAACTCTCTGCTT
GCCACAGGCGATGGTCAGGATACATTTGGTAATACTGGCGATGTCCGCATCCCTGCTCAACACACGGCTCCTGGA
ACGTTTGCCAATAGCGCCGGGTCAGGCGTACAACGAATCAACGCTGAGCCTACGGGAAATAATCCCTTTATGCGG
CAGCAGTTTACAGGAATGCCCAGCATCAGCTACGGCGGCCAAGCTTCAAATCCTGGTCTCTCTTTTGGCGGCCAC
GGTCCGGGGAACAACCCCTTTGGTGCTCAACCGCAGCAGCAGCAGCAGCAGCAGCCATCACAGAACCAAGATCTG
ATTCAACTCTAA
Gene >OphauG2|1648
ATGTCCAAGGTAATGCGAAGCGTCAAAAATGTGACCAAGGGTTACTCAAGCACCCAGGTCAAGGTGAGGGAAGGT
TCGTGCACCACTTCCCCTGGCTTTCCTTGTCATATGCTAACATGTGCATTCGACAGCAACAAGTAACGATCCATG
GGGTCCCACGGGGACTCAGATGAGCGAAATCGCGCAAATGACTTTTAATACGTCTGTCCCACATACTATTCCATG
ACTCCGTCCGCTATTCTGACTAGCATCTTGTCCACAGCTCAACTGAATTTTACGATATCATGGATATGCTTGACA
AGCGACTCAACGACAAGGGAAAGAACTGGCGGCATGTTCTCAAGGCCCTCAAGGTGCTTGATTACTGCCTGCACG
AGGGTTCCGAGTTGGTTGTTACTTGGGCTCGACAAAGCATTTACATCATCAAGACCCTGCGCGAGTTTCAATACA
TCGATGAGGAGGGCCGCGACGTAGGACAGAATGGTACTGATGCCACGCTCGACATGGTCTCATGGACGCTCCGCT
GATTCTTGTCAATTGTTAGTTCGAGTCACAGCCAAGGAGCTTACATCTCTAATCCTCGATGAAGAGCGGCTTCGA
GCTGAGCGTAGTGACAGGAGGATGTGGAAATCCCGAGTCCTGGAAGACTATGCGTCCCAGTTCCCCATCGCAGAG
CCTTCTCAGCTGCCACGGCCGCGCCGTGAAAGGCGGCCCATGGACGATGAAGAAGATACTGAATACCGACTGGCC
ATTGAGGCTAGCAAGCACCAAGAGGAGGAGGACAGGAGAAAGAGAGAAAGTCGAGACAACGACAATGATGATGAC
GACCTGGCAAAGGCAATCAAGCTAAGCAGAGAGGAGGAAGAGAGGCGGCGTCGTGAGCTCGAACAGAGCAATGCA
CCCTCTCTTTTCGACGACGAGCCCGTGCAGAATACTCAATCTCAGTACACCGGCTTCAATCAGGGATACCAACAA
GGGAACCCCGTCGACTTTTTTGCGAATCCCATTGACCAAAGCCAGATGCAGACGCAGCCAACCGGGTATATGAAC
AATGCCTACACCGGCTACCAGCAAACCCAGCCTACAGGCTTTCAGCCGGGCTACAACCCAGCTTTTGGCATGCAA
ACTGGCATGGGAATGGGCATGAACATGGATCAGTATGCACCACAGGCTTTCCAGCCCCAACCCACCGGCTATAAT
CCGTATGCGCAGCAACAGCTTCGAATGCAGTCTCCGCCCGCAGGCGAAGCCGCACTGCAGCCAGGAAGTAATAAT
CCTTGGGCCAGCAATAAAACACAGCAGCAATTCTTGAAGCCAACGCCTACCGGCTCCAACAATCCCTTCGCCCAG
CCCACCATCAACCGGCCCCAGTCGGCCAAGCCGGCCTCTTCGTCGTTGAGTCCGCTCCCGGAGCAGAATGCCATG
CCATCCTTCAACCTTTCGCGGCCTCAGCAACAGCAGCAGACAGCTTTCAACACTCCGCCAAAAAATAACCTGACC
GAATACCAGTCCAAGCTCAACTCTCTGCTTGCCACAGGCGATGGTCAGGATACATTTGGTAATACTGGCGATGTC
CGCATCCCTGCTCAACACACGGCTCCTGGAACGTTTGCCAATAGCGCCGGGTCAGGCGTACAACGAATCAACGCT
GAGCCTACGGGAAATAATCCCTTTATGCGGCAGCAGTTTACAGGAATGCCCAGCATCAGCTACGGCGGCCAAGCT
TCAAATCCTGGTCTCTCTTTTGGCGGCCACGGTCCGGGGAACAACCCCTTTGGTGCTCAACCGCAGCAGCAGCAG
CAGCAGCAGCCATCACAGAACCAAGATCTGATTCAACTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail