Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1643
Gene name
LocationContig_151:537..3396
Strand-
Gene length (bp)2859
Transcript length (bp)2745
Coding sequence length (bp)2745
Protein length (aa) 915

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10033 ATG13 Autophagy-related protein 13 1.1E-73 67 306

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7F7B2|ATG13_SCLS1 Autophagy-related protein 13 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg13 PE=3 SV=1 51 896 0.0E+00
sp|Q2ULT1|ATG13_ASPOR Autophagy-related protein 13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg13 PE=3 SV=1 1 781 8.0E-152
sp|Q4WHN5|ATG13_ASPFU Autophagy-related protein 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg13 PE=3 SV=1 1 777 6.0E-146
sp|Q5BBK4|ATG13_EMENI Autophagy-related protein 13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg13 PE=3 SV=1 54 781 1.0E-140
sp|A2QWA6|ATG13_ASPNC Autophagy-related protein 13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg13 PE=3 SV=1 51 781 2.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7F7B2|ATG13_SCLS1 Autophagy-related protein 13 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg13 PE=3 SV=1 51 896 0.0E+00
sp|Q2ULT1|ATG13_ASPOR Autophagy-related protein 13 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg13 PE=3 SV=1 1 781 8.0E-152
sp|Q4WHN5|ATG13_ASPFU Autophagy-related protein 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg13 PE=3 SV=1 1 777 6.0E-146
sp|Q5BBK4|ATG13_EMENI Autophagy-related protein 13 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg13 PE=3 SV=1 54 781 1.0E-140
sp|A2QWA6|ATG13_ASPNC Autophagy-related protein 13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg13 PE=3 SV=1 51 781 2.0E-140
sp|Q1E891|ATG13_COCIM Autophagy-related protein 13 OS=Coccidioides immitis (strain RS) GN=ATG13 PE=3 SV=1 61 777 2.0E-139
sp|Q0UPX4|ATG13_PHANO Autophagy-related protein 13 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG13 PE=3 SV=1 60 901 3.0E-139
sp|Q6C315|ATG13_YARLI Autophagy-related protein 13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG13 PE=3 SV=1 63 324 6.0E-43
sp|Q6BQ20|ATG13_DEBHA Autophagy-related protein 13 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG13 PE=3 SV=2 62 678 2.0E-39
sp|A5DQA8|ATG13_PICGU Autophagy-related protein 13 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG13 PE=3 SV=2 61 678 2.0E-36
sp|A3LQY1|ATG13_PICST Autophagy-related protein 13 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG13 PE=3 SV=2 62 632 3.0E-32
sp|Q5A1Z5|ATG13_CANAL Autophagy-related protein 13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG13 PE=3 SV=1 60 643 1.0E-30
sp|O36019|ATG13_SCHPO Autophagy protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg13 PE=1 SV=1 62 325 5.0E-28
sp|A7KAJ8|ATG13_PICAN Autophagy-related protein 13 OS=Pichia angusta GN=ATG13 PE=3 SV=1 50 320 1.0E-24
sp|Q6CWK2|ATG13_KLULA Autophagy-related protein 13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG13 PE=3 SV=1 65 347 1.0E-14
sp|Q758N2|ATG13_ASHGO Autophagy-related protein 13 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG13 PE=3 SV=1 56 310 5.0E-14
sp|Q9SCK0|AT13A_ARATH Autophagy-related protein 13a OS=Arabidopsis thaliana GN=ATG13A PE=1 SV=1 47 304 2.0E-13
sp|Q6FSJ9|ATG13_CANGA Autophagy-related protein 13 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG13 PE=3 SV=1 65 310 4.0E-12
sp|A7TTE2|ATG13_VANPO Autophagy-related protein 13 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG13 PE=3 SV=1 61 311 3.0E-10
sp|Q06628|ATG13_YEAST Autophagy-related protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG13 PE=1 SV=1 56 339 3.0E-10
sp|A6ZX59|ATG13_YEAS7 Autophagy-related protein 13 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG13 PE=3 SV=1 56 339 4.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:1990316 Atg1/ULK1 kinase complex Yes
GO:0006914 autophagy Yes
GO:1902494 catalytic complex No
GO:0061919 process utilizing autophagic mechanism No
GO:1902554 serine/threonine protein kinase complex No
GO:1990234 transferase complex No
GO:0032991 protein-containing complex No
GO:1902911 protein kinase complex No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0061695 transferase complex, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0044248 cellular catabolic process No
GO:0005575 cellular_component No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1643
MHQQPRVPPRLSPPQSAQPRPAATSAASRQGPGSSVSGRDIVSSPTMDGPSALRPAAESVKKLDQIVQNFYIKAA
VLIVDSRIKVKISQSSSGMRKTNKWYQIETDEIDDFRDELKIWKTCGSLENRPPPMIIEVYLDTSRLKDSQSLVI
IDDEGKRWDVMEQLSASRSSSGSGSSPGSVVKNTQVILERWRIELKQAGVAPMDDFGPILPTVYKKAIVFFRSLF
IATRLLPAWKFASQSASQNSHPALMPRCRILVSERASSQPDLLRQSIDGRTDPVMDYVFGDLDVPGGRLGASVTY
RNDCGFRIDDSESLLSSRFMGVDENFFRPSLPQREPGPELGRGLGLSNLQQAYGSLSTFHGGAPLGTSPLSALRA
VRPPGSDTSSPPASLPRNAGNGTPSSLPLWGRPSSPRVPVRPNDGSLRRPSISFQPFKAGSLSGSPVPRTLESES
PASTHSLSRPVGLPSGTNPRNRSSLTAGMPASLRGGPPPAAAETPVVGSPRPQSTGRYSSSFTHRKGRLSIGGPP
KSGTDEEQCSSGRQSLSSSIAQPGSGLLAEPGPASSGSLHGEEDDIQKFLKVLDSKKTLKSFEPSKRGESATNRT
VAQLSKFHMMKESNNALGDSMTSSMQMHRSSSSSSRQLTSVPGMVAPASVSTSTSPGKPVSPHTPHTPAIPSRLS
ENSIIDYSSTGRIVSRSGRRQEATVAEPNRENTITSEGTTAIDIPLSPRLGSYQRRSSSVAQQTRAVADDDEADL
AFAPHRSISLGADDREPPTMSTLLGRQMQMERLAGRRRHSSNLQPAAEVQTLDSGEAMQRGSADDNPPEGLIPSA
PSSSPMPRRRYGGLGAGRPTPQSSRGSFTGSVGRMGRADDESVSGEPLVFDFSEMDPQVRRSLEETPGGSQGRSE
RNVFEQRGTTRRGW*
Coding >OphauG2|1643
ATGCATCAGCAGCCTCGCGTGCCCCCCCGGCTCTCGCCGCCGCAGTCGGCACAGCCTCGACCTGCTGCCACTTCT
GCTGCGTCGCGTCAAGGTCCTGGCTCCAGTGTATCCGGCCGAGATATCGTCAGCTCCCCTACTATGGATGGCCCA
TCAGCACTGCGCCCAGCTGCTGAATCCGTCAAGAAGCTGGATCAGATTGTCCAGAACTTTTACATCAAGGCTGCC
GTCCTGATTGTCGACTCTCGCATCAAGGTCAAGATATCACAGAGCTCCAGCGGCATGCGAAAGACGAACAAATGG
TACCAAATCGAGACGGACGAGATTGATGACTTTAGGGACGAGCTCAAGATATGGAAGACGTGCGGGAGCCTCGAA
AACCGCCCGCCACCAATGATCATCGAAGTCTACCTCGATACATCGCGCCTCAAGGACAGCCAAAGCCTTGTCATT
ATCGATGACGAGGGCAAGCGCTGGGATGTCATGGAGCAGCTGAGTGCGTCGCGGTCCTCGAGCGGAAGCGGCTCC
TCGCCAGGCTCGGTTGTTAAGAATACACAAGTCATATTGGAGAGGTGGCGCATCGAGCTCAAGCAGGCTGGCGTG
GCGCCCATGGACGACTTTGGGCCCATCCTGCCGACAGTCTACAAGAAAGCCATTGTCTTTTTCAGGTCGCTCTTT
ATTGCTACCAGGCTGCTGCCAGCCTGGAAGTTTGCCAGCCAAAGCGCCTCGCAAAATTCACATCCAGCCTTGATG
CCTCGTTGCCGCATCTTGGTTTCTGAGAGGGCGTCATCACAGCCTGATTTGCTGAGGCAGTCCATCGATGGGCGT
ACAGATCCAGTCATGGACTACGTCTTTGGCGACCTTGACGTGCCAGGCGGACGTCTTGGTGCCTCTGTAACCTAC
CGAAACGACTGTGGGTTCCGCATTGACGATTCGGAGTCGCTGCTCAGCTCCCGGTTTATGGGCGTCGACGAGAAC
TTTTTCAGGCCTTCTTTACCACAGCGTGAGCCTGGCCCGGAGCTGGGCCGAGGTCTCGGTTTGAGCAACCTGCAG
CAGGCGTACGGCAGCTTGTCGACGTTTCACGGGGGGGCACCGCTGGGCACCAGTCCCCTTTCAGCGCTAAGAGCT
GTTCGACCCCCAGGCTCTGACACGAGCTCCCCTCCAGCCTCATTACCCAGGAACGCTGGCAACGGCACACCCAGT
TCTTTGCCTCTGTGGGGCCGTCCGAGTTCTCCACGAGTTCCTGTACGCCCAAACGACGGATCACTAAGGCGGCCG
TCAATATCGTTTCAGCCATTTAAAGCTGGTTCTCTGTCGGGTTCCCCTGTTCCCAGGACTCTCGAGTCGGAATCG
CCTGCATCCACACATTCTCTAAGCCGTCCAGTGGGCTTGCCATCTGGCACAAATCCCAGGAATCGGTCGAGCTTA
ACGGCGGGAATGCCCGCTTCACTGCGTGGTGGGCCTCCTCCTGCCGCGGCCGAGACGCCCGTGGTGGGATCGCCA
CGACCTCAATCTACTGGCCGATATAGTAGTAGTTTTACTCATCGTAAAGGGCGCCTTTCTATTGGAGGGCCGCCA
AAAAGCGGCACTGATGAAGAACAATGCAGCAGCGGGCGACAAAGCTTGTCATCGTCTATAGCACAGCCTGGCTCG
GGTCTTTTGGCTGAGCCCGGTCCAGCGAGCTCTGGCTCTCTTCACGGCGAGGAGGACGATATTCAAAAGTTCTTA
AAGGTGCTGGACAGTAAAAAGACACTCAAGAGCTTTGAGCCGAGCAAGAGAGGCGAATCGGCAACAAACAGAACA
GTGGCACAGCTTTCCAAATTTCACATGATGAAGGAGTCGAATAATGCGCTGGGAGACTCGATGACGTCGTCGATG
CAGATGCATCGCTCTTCGAGCTCGTCGAGCCGGCAGTTGACGAGCGTGCCTGGCATGGTGGCGCCGGCATCCGTC
TCGACATCGACGTCGCCCGGAAAGCCCGTCTCGCCACACACGCCGCACACGCCTGCTATCCCTTCGAGGTTGAGC
GAAAACTCAATCATAGATTACAGTTCAACGGGCAGGATTGTGTCGCGAAGCGGCCGCCGGCAAGAAGCCACAGTC
GCGGAGCCCAACAGAGAAAACACAATCACGTCTGAAGGCACGACTGCCATTGACATACCCCTCTCTCCACGATTG
GGATCGTATCAGCGCCGGTCAAGCTCAGTGGCTCAACAGACTCGAGCCGTGGCGGACGATGACGAGGCTGATTTG
GCATTTGCCCCTCACCGAAGCATCAGCCTGGGTGCTGATGACAGGGAGCCGCCGACAATGAGCACGCTTCTAGGA
AGGCAGATGCAGATGGAAAGATTGGCGGGGCGTCGGCGGCACAGTAGCAACCTGCAGCCTGCAGCAGAAGTGCAA
ACATTGGACTCGGGCGAGGCGATGCAGCGAGGCTCAGCAGATGATAATCCGCCCGAGGGACTGATTCCATCGGCT
CCCTCGAGCTCACCAATGCCAAGACGGCGTTATGGAGGTCTTGGAGCAGGCAGGCCGACTCCACAGTCATCGCGT
GGCAGCTTCACCGGATCAGTCGGGCGGATGGGGCGAGCAGACGACGAGTCTGTGAGTGGCGAGCCGCTGGTATTC
GACTTTTCAGAGATGGATCCGCAGGTGAGACGCAGTTTAGAGGAAACGCCCGGGGGGAGCCAGGGAAGGTCGGAA
CGAAACGTCTTTGAGCAACGCGGGACAACAAGGCGAGGATGGTGA
Transcript >OphauG2|1643
ATGCATCAGCAGCCTCGCGTGCCCCCCCGGCTCTCGCCGCCGCAGTCGGCACAGCCTCGACCTGCTGCCACTTCT
GCTGCGTCGCGTCAAGGTCCTGGCTCCAGTGTATCCGGCCGAGATATCGTCAGCTCCCCTACTATGGATGGCCCA
TCAGCACTGCGCCCAGCTGCTGAATCCGTCAAGAAGCTGGATCAGATTGTCCAGAACTTTTACATCAAGGCTGCC
GTCCTGATTGTCGACTCTCGCATCAAGGTCAAGATATCACAGAGCTCCAGCGGCATGCGAAAGACGAACAAATGG
TACCAAATCGAGACGGACGAGATTGATGACTTTAGGGACGAGCTCAAGATATGGAAGACGTGCGGGAGCCTCGAA
AACCGCCCGCCACCAATGATCATCGAAGTCTACCTCGATACATCGCGCCTCAAGGACAGCCAAAGCCTTGTCATT
ATCGATGACGAGGGCAAGCGCTGGGATGTCATGGAGCAGCTGAGTGCGTCGCGGTCCTCGAGCGGAAGCGGCTCC
TCGCCAGGCTCGGTTGTTAAGAATACACAAGTCATATTGGAGAGGTGGCGCATCGAGCTCAAGCAGGCTGGCGTG
GCGCCCATGGACGACTTTGGGCCCATCCTGCCGACAGTCTACAAGAAAGCCATTGTCTTTTTCAGGTCGCTCTTT
ATTGCTACCAGGCTGCTGCCAGCCTGGAAGTTTGCCAGCCAAAGCGCCTCGCAAAATTCACATCCAGCCTTGATG
CCTCGTTGCCGCATCTTGGTTTCTGAGAGGGCGTCATCACAGCCTGATTTGCTGAGGCAGTCCATCGATGGGCGT
ACAGATCCAGTCATGGACTACGTCTTTGGCGACCTTGACGTGCCAGGCGGACGTCTTGGTGCCTCTGTAACCTAC
CGAAACGACTGTGGGTTCCGCATTGACGATTCGGAGTCGCTGCTCAGCTCCCGGTTTATGGGCGTCGACGAGAAC
TTTTTCAGGCCTTCTTTACCACAGCGTGAGCCTGGCCCGGAGCTGGGCCGAGGTCTCGGTTTGAGCAACCTGCAG
CAGGCGTACGGCAGCTTGTCGACGTTTCACGGGGGGGCACCGCTGGGCACCAGTCCCCTTTCAGCGCTAAGAGCT
GTTCGACCCCCAGGCTCTGACACGAGCTCCCCTCCAGCCTCATTACCCAGGAACGCTGGCAACGGCACACCCAGT
TCTTTGCCTCTGTGGGGCCGTCCGAGTTCTCCACGAGTTCCTGTACGCCCAAACGACGGATCACTAAGGCGGCCG
TCAATATCGTTTCAGCCATTTAAAGCTGGTTCTCTGTCGGGTTCCCCTGTTCCCAGGACTCTCGAGTCGGAATCG
CCTGCATCCACACATTCTCTAAGCCGTCCAGTGGGCTTGCCATCTGGCACAAATCCCAGGAATCGGTCGAGCTTA
ACGGCGGGAATGCCCGCTTCACTGCGTGGTGGGCCTCCTCCTGCCGCGGCCGAGACGCCCGTGGTGGGATCGCCA
CGACCTCAATCTACTGGCCGATATAGTAGTAGTTTTACTCATCGTAAAGGGCGCCTTTCTATTGGAGGGCCGCCA
AAAAGCGGCACTGATGAAGAACAATGCAGCAGCGGGCGACAAAGCTTGTCATCGTCTATAGCACAGCCTGGCTCG
GGTCTTTTGGCTGAGCCCGGTCCAGCGAGCTCTGGCTCTCTTCACGGCGAGGAGGACGATATTCAAAAGTTCTTA
AAGGTGCTGGACAGTAAAAAGACACTCAAGAGCTTTGAGCCGAGCAAGAGAGGCGAATCGGCAACAAACAGAACA
GTGGCACAGCTTTCCAAATTTCACATGATGAAGGAGTCGAATAATGCGCTGGGAGACTCGATGACGTCGTCGATG
CAGATGCATCGCTCTTCGAGCTCGTCGAGCCGGCAGTTGACGAGCGTGCCTGGCATGGTGGCGCCGGCATCCGTC
TCGACATCGACGTCGCCCGGAAAGCCCGTCTCGCCACACACGCCGCACACGCCTGCTATCCCTTCGAGGTTGAGC
GAAAACTCAATCATAGATTACAGTTCAACGGGCAGGATTGTGTCGCGAAGCGGCCGCCGGCAAGAAGCCACAGTC
GCGGAGCCCAACAGAGAAAACACAATCACGTCTGAAGGCACGACTGCCATTGACATACCCCTCTCTCCACGATTG
GGATCGTATCAGCGCCGGTCAAGCTCAGTGGCTCAACAGACTCGAGCCGTGGCGGACGATGACGAGGCTGATTTG
GCATTTGCCCCTCACCGAAGCATCAGCCTGGGTGCTGATGACAGGGAGCCGCCGACAATGAGCACGCTTCTAGGA
AGGCAGATGCAGATGGAAAGATTGGCGGGGCGTCGGCGGCACAGTAGCAACCTGCAGCCTGCAGCAGAAGTGCAA
ACATTGGACTCGGGCGAGGCGATGCAGCGAGGCTCAGCAGATGATAATCCGCCCGAGGGACTGATTCCATCGGCT
CCCTCGAGCTCACCAATGCCAAGACGGCGTTATGGAGGTCTTGGAGCAGGCAGGCCGACTCCACAGTCATCGCGT
GGCAGCTTCACCGGATCAGTCGGGCGGATGGGGCGAGCAGACGACGAGTCTGTGAGTGGCGAGCCGCTGGTATTC
GACTTTTCAGAGATGGATCCGCAGGTGAGACGCAGTTTAGAGGAAACGCCCGGGGGGAGCCAGGGAAGGTCGGAA
CGAAACGTCTTTGAGCAACGCGGGACAACAAGGCGAGGATGGTGA
Gene >OphauG2|1643
ATGCATCAGCAGCCTCGCGTGCCCCCCCGGCTCTCGCCGCCGCAGTCGGCACAGCCTCGACCTGCTGCCACTTCT
GCTGCGTCGCGTCAAGGTCCTGGCTCCAGTGTATCCGGCCGAGATATCGTCAGCTCCCCTACTATGGATGGCCCA
TCAGCACTGCGCCCAGCTGCTGAATCCGTCAAGAAGCTGGATCAGATTGTCCAGGTACACTCAGAGCTATACTTG
CCCTTCTTGCAGGTGCTGACCGCCCCAGAACTTTTACATCAAGGCTGCCGTCCTGATTGTCGACTCTCGCATCAA
GGTCAAGATATCACAGAGCTCCAGCGGCATGCGAAAGACGAACAAATGGGTAAATCATTCCCTAGCACTTGTCCA
TGTCCCTTGATGTCCAGGCTAACCCACCCACTCGCACAGTACCAAATCGAGACGGACGAGATTGATGACTTTAGG
GACGAGCTCAAGATATGGAAGACGTGCGGGAGCCTCGAAAACCGCCCGCCACCAATGATCATCGAAGTCTACCTC
GATACATCGCGCCTCAAGGACAGCCAAAGCCTTGTCATTATCGATGACGAGGGCAAGCGCTGGGATGTCATGGAG
CAGCTGAGTGCGTCGCGGTCCTCGAGCGGAAGCGGCTCCTCGCCAGGCTCGGTTGTTAAGAATACACAAGTCATA
TTGGAGAGGTGGCGCATCGAGCTCAAGCAGGCTGGCGTGGCGCCCATGGACGACTTTGGGCCCATCCTGCCGACA
GTCTACAAGAAAGCCATTGTCTTTTTCAGGTCGCTCTTTATTGCTACCAGGCTGCTGCCAGCCTGGAAGTTTGCC
AGCCAAAGCGCCTCGCAAAATTCACATCCAGCCTTGATGCCTCGTTGCCGCATCTTGGTTTCTGAGAGGGCGTCA
TCACAGCCTGATTTGCTGAGGCAGTCCATCGATGGGCGTACAGATCCAGTCATGGACTACGTCTTTGGCGACCTT
GACGTGCCAGGCGGACGTCTTGGTGCCTCTGTAACCTACCGAAACGACTGTGGGTTCCGCATTGACGATTCGGAG
TCGCTGCTCAGCTCCCGGTTTATGGGCGTCGACGAGAACTTTTTCAGGCCTTCTTTACCACAGCGTGAGCCTGGC
CCGGAGCTGGGCCGAGGTCTCGGTTTGAGCAACCTGCAGCAGGCGTACGGCAGCTTGTCGACGTTTCACGGGGGG
GCACCGCTGGGCACCAGTCCCCTTTCAGCGCTAAGAGCTGTTCGACCCCCAGGCTCTGACACGAGCTCCCCTCCA
GCCTCATTACCCAGGAACGCTGGCAACGGCACACCCAGTTCTTTGCCTCTGTGGGGCCGTCCGAGTTCTCCACGA
GTTCCTGTACGCCCAAACGACGGATCACTAAGGCGGCCGTCAATATCGTTTCAGCCATTTAAAGCTGGTTCTCTG
TCGGGTTCCCCTGTTCCCAGGACTCTCGAGTCGGAATCGCCTGCATCCACACATTCTCTAAGCCGTCCAGTGGGC
TTGCCATCTGGCACAAATCCCAGGAATCGGTCGAGCTTAACGGCGGGAATGCCCGCTTCACTGCGTGGTGGGCCT
CCTCCTGCCGCGGCCGAGACGCCCGTGGTGGGATCGCCACGACCTCAATCTACTGGCCGATATAGTAGTAGTTTT
ACTCATCGTAAAGGGCGCCTTTCTATTGGAGGGCCGCCAAAAAGCGGCACTGATGAAGAACAATGCAGCAGCGGG
CGACAAAGCTTGTCATCGTCTATAGCACAGCCTGGCTCGGGTCTTTTGGCTGAGCCCGGTCCAGCGAGCTCTGGC
TCTCTTCACGGCGAGGAGGACGATATTCAAAAGTTCTTAAAGGTGCTGGACAGTAAAAAGACACTCAAGAGCTTT
GAGCCGAGCAAGAGAGGCGAATCGGCAACAAACAGAACAGTGGCACAGCTTTCCAAATTTCACATGATGAAGGAG
TCGAATAATGCGCTGGGAGACTCGATGACGTCGTCGATGCAGATGCATCGCTCTTCGAGCTCGTCGAGCCGGCAG
TTGACGAGCGTGCCTGGCATGGTGGCGCCGGCATCCGTCTCGACATCGACGTCGCCCGGAAAGCCCGTCTCGCCA
CACACGCCGCACACGCCTGCTATCCCTTCGAGGTTGAGCGAAAACTCAATCATAGATTACAGTTCAACGGGCAGG
ATTGTGTCGCGAAGCGGCCGCCGGCAAGAAGCCACAGTCGCGGAGCCCAACAGAGAAAACACAATCACGTCTGAA
GGCACGACTGCCATTGACATACCCCTCTCTCCACGATTGGGATCGTATCAGCGCCGGTCAAGCTCAGTGGCTCAA
CAGACTCGAGCCGTGGCGGACGATGACGAGGCTGATTTGGCATTTGCCCCTCACCGAAGCATCAGCCTGGGTGCT
GATGACAGGGAGCCGCCGACAATGAGCACGCTTCTAGGAAGGCAGATGCAGATGGAAAGATTGGCGGGGCGTCGG
CGGCACAGTAGCAACCTGCAGCCTGCAGCAGAAGTGCAAACATTGGACTCGGGCGAGGCGATGCAGCGAGGCTCA
GCAGATGATAATCCGCCCGAGGGACTGATTCCATCGGCTCCCTCGAGCTCACCAATGCCAAGACGGCGTTATGGA
GGTCTTGGAGCAGGCAGGCCGACTCCACAGTCATCGCGTGGCAGCTTCACCGGATCAGTCGGGCGGATGGGGCGA
GCAGACGACGAGTCTGTGAGTGGCGAGCCGCTGGTATTCGACTTTTCAGAGATGGATCCGCAGGTGAGACGCAGT
TTAGAGGAAACGCCCGGGGGGAGCCAGGGAAGGTCGGAACGAAACGTCTTTGAGCAACGCGGGACAACAAGGCGA
GGATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail