Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1638
Gene name
LocationContig_1506:602..3185
Strand+
Gene length (bp)2583
Transcript length (bp)2493
Coding sequence length (bp)2493
Protein length (aa) 831

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 3.3E-76 111 336
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 2.0E-13 461 519

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P49426|EXG1_COCCA Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum GN=EXG1 PE=1 SV=1 88 829 4.0E-169
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 387 829 4.0E-142
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 81 436 3.0E-111
sp|P53626|E13B_TRIHA Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum GN=bgn13.1 PE=1 SV=1 105 810 7.0E-57

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1638
MVPSVVAVGAALLALTWHHAAASNADNAVPVGLRSESAGGEGVAGKPGCHVGTAARAKTADEEAEDKEAQEAAGG
VMTATTSSLDTSGWWFADIARQGRATYNQDGEYKVFRNVKDFGAVGDGQADDTRAINEAMAAGGRCGQGCTSSTT
TPAIVYFPPGTYLVSAPLVPYYYSQMVGDAVRVPTLKAAPGFQGTAVIDANPYLPGGDNWYLNTNNFFRQVRNLR
IDLTALPLNTDAVGIHWQVAQATSLENMEFVMRDDPSPDNKQRGLLMENGSGGFMANLTFVGGSVAASVASQQFT
LRDASFRNCHTAISMRWNWVWALQNIRIDNCRLGLDMAPDGPDQHVGSIVLLDSVVSNTPVAIRTAYSPAQMGTN
GTLVLDNVDMSANVPVAVQGLPSATVVPGNTKIQSYVQGRAYKAAAAQATQGLRPAVPRPPALVDAAGNFVSRGK
PAYRDVPASSFVSVKSAGAKGDGVSDDTKALQAVFSSLRPDHIVYFDHGTYLVTDTIQVPSNVRIVGELWPLIMA
AGDKAFKDQANPRPVFRVGSPGDEGVVEMQDIVLSTQGPQPGAILLEFNVKGAQQASTALWDVHFRIGGFTGTRL
QSDRCLLKPDADPAAAPDPACLGAFMLLHVTPQATIYMENTWLWVADHELDIAGQDKLTIFNGRGLVLESTQGAW
LYGTASEHNVLSNYQISNAKNVFMALIQTETAYFQGTPDARKPFTPNPTYFDPDMNAECGDSPKCARTWGLRVQD
SSNVLLYGAGLYSLFDSNNEACADTNNCQDNMVSIARSQVHMAGLSTKASVNMVTLDGATAALDADNRNTFCGTI
AMFES*
Coding >OphauG2|1638
ATGGTTCCCTCAGTTGTTGCCGTGGGCGCGGCTCTGCTGGCATTGACCTGGCATCATGCTGCAGCCAGCAATGCC
GACAATGCAGTGCCTGTTGGTCTGCGTTCTGAATCTGCCGGGGGCGAGGGAGTTGCAGGCAAGCCAGGGTGTCAT
GTTGGCACGGCGGCGAGGGCCAAGACGGCGGATGAGGAGGCGGAGGACAAGGAGGCCCAAGAGGCGGCTGGCGGG
GTGATGACGGCGACGACGAGCAGTTTGGACACGTCGGGGTGGTGGTTTGCCGACATTGCTCGCCAGGGCCGGGCG
ACGTACAACCAAGACGGCGAGTACAAGGTGTTCCGCAACGTCAAGGACTTTGGGGCCGTGGGCGACGGGCAGGCC
GACGACACAAGGGCCATCAACGAGGCCATGGCGGCGGGCGGGCGCTGCGGGCAGGGATGCACGTCGAGCACCACG
ACGCCGGCCATTGTCTACTTCCCGCCCGGCACATATCTCGTGTCGGCGCCGCTGGTGCCCTACTACTACTCGCAG
ATGGTGGGCGACGCGGTGCGCGTGCCGACGCTCAAGGCGGCCCCCGGCTTCCAGGGCACGGCCGTCATCGACGCC
AACCCCTATCTGCCCGGCGGCGACAACTGGTACCTCAACACCAACAACTTCTTCCGCCAGGTGCGCAACTTGCGC
ATCGACCTGACGGCCCTGCCGCTCAACACCGACGCGGTGGGCATCCACTGGCAGGTGGCCCAGGCCACGTCGCTC
GAGAACATGGAGTTTGTCATGCGCGACGACCCCAGCCCCGACAACAAGCAGCGCGGCCTGCTCATGGAGAATGGC
TCGGGCGGCTTCATGGCCAACCTGACCTTTGTCGGCGGCAGCGTCGCCGCGTCCGTCGCCAGCCAGCAGTTCACC
CTGCGCGACGCCAGCTTCCGCAACTGCCACACCGCCATCTCCATGCGCTGGAACTGGGTCTGGGCCCTGCAAAAC
ATCCGCATCGACAACTGCCGCCTGGGGCTCGACATGGCCCCCGACGGCCCCGACCAGCACGTCGGCTCCATCGTC
CTGCTCGACAGCGTCGTTTCCAACACCCCCGTCGCCATCCGCACCGCCTACTCGCCCGCCCAGATGGGCACCAAC
GGCACCCTCGTCCTGGACAATGTCGACATGTCTGCCAACGTGCCCGTCGCCGTCCAGGGCTTGCCGTCTGCCACC
GTCGTCCCCGGCAACACCAAGATCCAGTCCTATGTCCAGGGCCGCGCCTACAAGGCTGCCGCCGCCCAGGCCACC
CAGGGGCTCCGGCCCGCCGTCCCGCGCCCCCCGGCGCTCGTCGACGCCGCCGGCAACTTTGTCTCGCGCGGCAAG
CCGGCCTATCGCGACGTGCCCGCCTCGAGCTTCGTGTCGGTCAAGTCGGCCGGTGCAAAGGGCGATGGCGTCAGC
GACGACACCAAGGCCCTGCAGGCCGTCTTCAGCTCCCTGCGCCCCGACCACATTGTCTACTTTGACCACGGAACC
TACCTCGTCACAGACACCATCCAGGTCCCCAGCAACGTCAGGATTGTCGGCGAGCTCTGGCCGCTCATCATGGCT
GCCGGCGACAAGGCCTTCAAGGACCAGGCCAACCCCCGGCCCGTCTTCCGCGTCGGCAGCCCGGGCGACGAGGGC
GTCGTCGAGATGCAAGACATTGTGCTCTCCACCCAGGGCCCTCAGCCTGGCGCCATCCTGCTCGAGTTCAACGTC
AAGGGCGCCCAGCAAGCATCCACCGCCCTCTGGGACGTCCACTTTCGCATCGGCGGCTTCACCGGCACTCGTCTG
CAGTCTGACCGCTGCCTCCTCAAGCCAGATGCCGACCCGGCGGCGGCCCCCGACCCCGCCTGCTTGGGCGCCTTT
ATGCTCCTCCACGTCACCCCCCAGGCCACCATCTACATGGAAAACACCTGGCTCTGGGTCGCCGACCACGAACTC
GACATTGCCGGCCAAGACAAGCTCACCATCTTCAACGGCCGCGGCCTGGTCCTCGAAAGCACCCAGGGCGCCTGG
CTCTACGGCACTGCCTCGGAGCACAATGTCCTGTCCAACTACCAAATCAGCAACGCCAAAAACGTCTTCATGGCC
CTCATCCAGACCGAGACGGCCTATTTCCAGGGCACCCCAGACGCCCGCAAGCCCTTTACGCCCAACCCCACCTAC
TTTGATCCCGACATGAACGCCGAGTGCGGCGACTCGCCCAAGTGTGCCCGCACCTGGGGCCTTCGTGTGCAAGAC
TCGTCCAACGTCTTGCTCTACGGCGCCGGCCTCTACAGTCTCTTTGACAGCAATAATGAAGCCTGCGCCGACACC
AACAACTGCCAGGACAACATGGTTAGCATTGCCAGATCCCAGGTCCATATGGCCGGCCTTAGCACCAAGGCCAGC
GTCAACATGGTCACCCTCGACGGCGCCACGGCTGCGCTGGATGCCGACAACAGAAACACCTTTTGTGGGACTATT
GCCATGTTTGAGTCGTGA
Transcript >OphauG2|1638
ATGGTTCCCTCAGTTGTTGCCGTGGGCGCGGCTCTGCTGGCATTGACCTGGCATCATGCTGCAGCCAGCAATGCC
GACAATGCAGTGCCTGTTGGTCTGCGTTCTGAATCTGCCGGGGGCGAGGGAGTTGCAGGCAAGCCAGGGTGTCAT
GTTGGCACGGCGGCGAGGGCCAAGACGGCGGATGAGGAGGCGGAGGACAAGGAGGCCCAAGAGGCGGCTGGCGGG
GTGATGACGGCGACGACGAGCAGTTTGGACACGTCGGGGTGGTGGTTTGCCGACATTGCTCGCCAGGGCCGGGCG
ACGTACAACCAAGACGGCGAGTACAAGGTGTTCCGCAACGTCAAGGACTTTGGGGCCGTGGGCGACGGGCAGGCC
GACGACACAAGGGCCATCAACGAGGCCATGGCGGCGGGCGGGCGCTGCGGGCAGGGATGCACGTCGAGCACCACG
ACGCCGGCCATTGTCTACTTCCCGCCCGGCACATATCTCGTGTCGGCGCCGCTGGTGCCCTACTACTACTCGCAG
ATGGTGGGCGACGCGGTGCGCGTGCCGACGCTCAAGGCGGCCCCCGGCTTCCAGGGCACGGCCGTCATCGACGCC
AACCCCTATCTGCCCGGCGGCGACAACTGGTACCTCAACACCAACAACTTCTTCCGCCAGGTGCGCAACTTGCGC
ATCGACCTGACGGCCCTGCCGCTCAACACCGACGCGGTGGGCATCCACTGGCAGGTGGCCCAGGCCACGTCGCTC
GAGAACATGGAGTTTGTCATGCGCGACGACCCCAGCCCCGACAACAAGCAGCGCGGCCTGCTCATGGAGAATGGC
TCGGGCGGCTTCATGGCCAACCTGACCTTTGTCGGCGGCAGCGTCGCCGCGTCCGTCGCCAGCCAGCAGTTCACC
CTGCGCGACGCCAGCTTCCGCAACTGCCACACCGCCATCTCCATGCGCTGGAACTGGGTCTGGGCCCTGCAAAAC
ATCCGCATCGACAACTGCCGCCTGGGGCTCGACATGGCCCCCGACGGCCCCGACCAGCACGTCGGCTCCATCGTC
CTGCTCGACAGCGTCGTTTCCAACACCCCCGTCGCCATCCGCACCGCCTACTCGCCCGCCCAGATGGGCACCAAC
GGCACCCTCGTCCTGGACAATGTCGACATGTCTGCCAACGTGCCCGTCGCCGTCCAGGGCTTGCCGTCTGCCACC
GTCGTCCCCGGCAACACCAAGATCCAGTCCTATGTCCAGGGCCGCGCCTACAAGGCTGCCGCCGCCCAGGCCACC
CAGGGGCTCCGGCCCGCCGTCCCGCGCCCCCCGGCGCTCGTCGACGCCGCCGGCAACTTTGTCTCGCGCGGCAAG
CCGGCCTATCGCGACGTGCCCGCCTCGAGCTTCGTGTCGGTCAAGTCGGCCGGTGCAAAGGGCGATGGCGTCAGC
GACGACACCAAGGCCCTGCAGGCCGTCTTCAGCTCCCTGCGCCCCGACCACATTGTCTACTTTGACCACGGAACC
TACCTCGTCACAGACACCATCCAGGTCCCCAGCAACGTCAGGATTGTCGGCGAGCTCTGGCCGCTCATCATGGCT
GCCGGCGACAAGGCCTTCAAGGACCAGGCCAACCCCCGGCCCGTCTTCCGCGTCGGCAGCCCGGGCGACGAGGGC
GTCGTCGAGATGCAAGACATTGTGCTCTCCACCCAGGGCCCTCAGCCTGGCGCCATCCTGCTCGAGTTCAACGTC
AAGGGCGCCCAGCAAGCATCCACCGCCCTCTGGGACGTCCACTTTCGCATCGGCGGCTTCACCGGCACTCGTCTG
CAGTCTGACCGCTGCCTCCTCAAGCCAGATGCCGACCCGGCGGCGGCCCCCGACCCCGCCTGCTTGGGCGCCTTT
ATGCTCCTCCACGTCACCCCCCAGGCCACCATCTACATGGAAAACACCTGGCTCTGGGTCGCCGACCACGAACTC
GACATTGCCGGCCAAGACAAGCTCACCATCTTCAACGGCCGCGGCCTGGTCCTCGAAAGCACCCAGGGCGCCTGG
CTCTACGGCACTGCCTCGGAGCACAATGTCCTGTCCAACTACCAAATCAGCAACGCCAAAAACGTCTTCATGGCC
CTCATCCAGACCGAGACGGCCTATTTCCAGGGCACCCCAGACGCCCGCAAGCCCTTTACGCCCAACCCCACCTAC
TTTGATCCCGACATGAACGCCGAGTGCGGCGACTCGCCCAAGTGTGCCCGCACCTGGGGCCTTCGTGTGCAAGAC
TCGTCCAACGTCTTGCTCTACGGCGCCGGCCTCTACAGTCTCTTTGACAGCAATAATGAAGCCTGCGCCGACACC
AACAACTGCCAGGACAACATGGTTAGCATTGCCAGATCCCAGGTCCATATGGCCGGCCTTAGCACCAAGGCCAGC
GTCAACATGGTCACCCTCGACGGCGCCACGGCTGCGCTGGATGCCGACAACAGAAACACCTTTTGTGGGACTATT
GCCATGTTTGAGTCGTGA
Gene >OphauG2|1638
ATGGTTCCCTCAGTTGTTGCCGTGGGCGCGGCTCTGCTGGCATTGACCTGGCATCATGCTGCAGCCAGCAATGCC
GACAATGCAGTGCCTGTTGGTCTGCGTTCTGAATCTGCCGGGTAAGGAGTCTTGACGGCCATGGAGGAGGGTGTC
GGGCTGGTAAAAAGCGAGACGACATGTGTTTGCTGACGGCATAATGCATGGCATAGGGGCGAGGGAGTTGCAGGC
AAGCCAGGGTGTCATGTTGGCACGGCGGCGAGGGCCAAGACGGCGGATGAGGAGGCGGAGGACAAGGAGGCCCAA
GAGGCGGCTGGCGGGGTGATGACGGCGACGACGAGCAGTTTGGACACGTCGGGGTGGTGGTTTGCCGACATTGCT
CGCCAGGGCCGGGCGACGTACAACCAAGACGGCGAGTACAAGGTGTTCCGCAACGTCAAGGACTTTGGGGCCGTG
GGCGACGGGCAGGCCGACGACACAAGGGCCATCAACGAGGCCATGGCGGCGGGCGGGCGCTGCGGGCAGGGATGC
ACGTCGAGCACCACGACGCCGGCCATTGTCTACTTCCCGCCCGGCACATATCTCGTGTCGGCGCCGCTGGTGCCC
TACTACTACTCGCAGATGGTGGGCGACGCGGTGCGCGTGCCGACGCTCAAGGCGGCCCCCGGCTTCCAGGGCACG
GCCGTCATCGACGCCAACCCCTATCTGCCCGGCGGCGACAACTGGTACCTCAACACCAACAACTTCTTCCGCCAG
GTGCGCAACTTGCGCATCGACCTGACGGCCCTGCCGCTCAACACCGACGCGGTGGGCATCCACTGGCAGGTGGCC
CAGGCCACGTCGCTCGAGAACATGGAGTTTGTCATGCGCGACGACCCCAGCCCCGACAACAAGCAGCGCGGCCTG
CTCATGGAGAATGGCTCGGGCGGCTTCATGGCCAACCTGACCTTTGTCGGCGGCAGCGTCGCCGCGTCCGTCGCC
AGCCAGCAGTTCACCCTGCGCGACGCCAGCTTCCGCAACTGCCACACCGCCATCTCCATGCGCTGGAACTGGGTC
TGGGCCCTGCAAAACATCCGCATCGACAACTGCCGCCTGGGGCTCGACATGGCCCCCGACGGCCCCGACCAGCAC
GTCGGCTCCATCGTCCTGCTCGACAGCGTCGTTTCCAACACCCCCGTCGCCATCCGCACCGCCTACTCGCCCGCC
CAGATGGGCACCAACGGCACCCTCGTCCTGGACAATGTCGACATGTCTGCCAACGTGCCCGTCGCCGTCCAGGGC
TTGCCGTCTGCCACCGTCGTCCCCGGCAACACCAAGATCCAGTCCTATGTCCAGGGCCGCGCCTACAAGGCTGCC
GCCGCCCAGGCCACCCAGGGGCTCCGGCCCGCCGTCCCGCGCCCCCCGGCGCTCGTCGACGCCGCCGGCAACTTT
GTCTCGCGCGGCAAGCCGGCCTATCGCGACGTGCCCGCCTCGAGCTTCGTGTCGGTCAAGTCGGCCGGTGCAAAG
GGCGATGGCGTCAGCGACGACACCAAGGCCCTGCAGGCCGTCTTCAGCTCCCTGCGCCCCGACCACATTGTCTAC
TTTGACCACGGAACCTACCTCGTCACAGACACCATCCAGGTCCCCAGCAACGTCAGGATTGTCGGCGAGCTCTGG
CCGCTCATCATGGCTGCCGGCGACAAGGCCTTCAAGGACCAGGCCAACCCCCGGCCCGTCTTCCGCGTCGGCAGC
CCGGGCGACGAGGGCGTCGTCGAGATGCAAGACATTGTGCTCTCCACCCAGGGCCCTCAGCCTGGCGCCATCCTG
CTCGAGTTCAACGTCAAGGGCGCCCAGCAAGCATCCACCGCCCTCTGGGACGTCCACTTTCGCATCGGCGGCTTC
ACCGGCACTCGTCTGCAGTCTGACCGCTGCCTCCTCAAGCCAGATGCCGACCCGGCGGCGGCCCCCGACCCCGCC
TGCTTGGGCGCCTTTATGCTCCTCCACGTCACCCCCCAGGCCACCATCTACATGGAAAACACCTGGCTCTGGGTC
GCCGACCACGAACTCGACATTGCCGGCCAAGACAAGCTCACCATCTTCAACGGCCGCGGCCTGGTCCTCGAAAGC
ACCCAGGGCGCCTGGCTCTACGGCACTGCCTCGGAGCACAATGTCCTGTCCAACTACCAAATCAGCAACGCCAAA
AACGTCTTCATGGCCCTCATCCAGACCGAGACGGCCTATTTCCAGGGCACCCCAGACGCCCGCAAGCCCTTTACG
CCCAACCCCACCTACTTTGATCCCGACATGAACGCCGAGTGCGGCGACTCGCCCAAGTGTGCCCGCACCTGGGGC
CTTCGTGTGCAAGACTCGTCCAACGTCTTGCTCTACGGCGCCGGCCTCTACAGTCTCTTTGACAGCAATAATGAA
GCCTGCGCCGACACCAACAACTGCCAGGACAACATGGTTAGCATTGCCAGATCCCAGGTCCATATGGCCGGCCTT
AGCACCAAGGCCAGCGTCAACATGGTCACCCTCGACGGCGCCACGGCTGCGCTGGATGCCGACAACAGAAACACC
TTTTGTGGGACTATTGCCATGTTTGAGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail