Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1636
Gene name
LocationContig_1504:1963..2821
Strand-
Gene length (bp)858
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05529 Bap31 Bap31/Bap29 transmembrane region 1.5E-49 1 137
PF18035 Bap31_Bap29_C Bap31/Bap29 cytoplasmic coiled-coil domain 1.4E-11 160 207

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14290|YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.04 PE=4 SV=1 1 194 1.0E-36
sp|Q07451|YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET3 PE=1 SV=1 1 180 1.0E-32
sp|P35723|YET1_YEAST Endoplasmic reticulum transmembrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET1 PE=1 SV=2 14 191 2.0E-15
sp|Q04210|YET2_YEAST Endoplasmic reticulum transmembrane protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET2 PE=1 SV=1 1 181 9.0E-15
sp|Q61334|BAP29_MOUSE B-cell receptor-associated protein 29 OS=Mus musculus GN=Bcap29 PE=1 SV=1 1 209 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14290|YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9E9.04 PE=4 SV=1 1 194 1.0E-36
sp|Q07451|YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET3 PE=1 SV=1 1 180 1.0E-32
sp|P35723|YET1_YEAST Endoplasmic reticulum transmembrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET1 PE=1 SV=2 14 191 2.0E-15
sp|Q04210|YET2_YEAST Endoplasmic reticulum transmembrane protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YET2 PE=1 SV=1 1 181 9.0E-15
sp|Q61334|BAP29_MOUSE B-cell receptor-associated protein 29 OS=Mus musculus GN=Bcap29 PE=1 SV=1 1 209 4.0E-12
sp|Q54K74|YETL_DICDI Endoplasmic reticulum transmembrane protein YET-like OS=Dictyostelium discoideum GN=DDB_G0287543 PE=3 SV=2 1 204 1.0E-10
sp|Q9UHQ4|BAP29_HUMAN B-cell receptor-associated protein 29 OS=Homo sapiens GN=BCAP29 PE=1 SV=2 1 201 2.0E-10
sp|Q5R9U7|BAP29_PONAB B-cell receptor-associated protein 29 OS=Pongo abelii GN=BCAP29 PE=2 SV=1 1 201 2.0E-10
sp|Q32KL9|BAP29_BOVIN B-cell receptor-associated protein 29 OS=Bos taurus GN=BCAP29 PE=2 SV=1 1 207 6.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 63 19
3 105 127 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1636
MTLYYTLVFSLLVLEMGLFMLLVMPMPFNAKRRVFTFISENPLVAKVQYWMKITFVFILILFLDSVNRVYRVQIE
LTASAENKGPTIIGSERLEVQARKFYSQRNMYLCGFTLFLSLILNRTYVMILEMMRLEDRLRTYEGTNKNTKESE
KLANAGKPGELGKLREKLAQKERDLETLKKQSAQLHKSYDELTDKYAATQNSGEARKEK*
Coding >OphauG2|1636
ATGACGCTCTACTACACTCTGGTTTTTTCGCTTCTCGTCTTGGAGATGGGTCTCTTTATGCTCTTGGTTATGCCG
ATGCCGTTTAACGCTAAGCGCAGAGTCTTTACCTTCATCTCGGAAAACCCCCTGGTGGCCAAGGTTCAGTATTGG
ATGAAGATTACCTTTGTCTTTATCCTCATTCTCTTCCTTGACAGCGTCAATCGGGTCTATCGTGTTCAGATTGAG
CTCACGGCGTCTGCTGAAAACAAGGGCCCGACGATTATTGGTTCGGAGCGGCTCGAGGTGCAGGCTCGCAAGTTT
TACTCGCAGCGCAACATGTATCTTTGCGGCTTCACCCTCTTCCTATCCCTCATCCTCAACCGCACCTATGTCATG
ATTCTCGAAATGATGCGACTGGAGGACCGCCTCCGGACTTATGAGGGCACAAACAAGAACACCAAGGAGAGCGAG
AAGCTGGCCAATGCTGGCAAACCGGGCGAATTGGGCAAGCTGCGCGAGAAGCTGGCACAAAAGGAACGCGATCTC
GAGACGCTCAAGAAGCAGAGCGCACAGCTTCACAAGAGCTACGACGAGTTGACGGACAAGTATGCTGCCACACAA
AATTCTGGCGAGGCGCGCAAGGAAAAATAG
Transcript >OphauG2|1636
ATGACGCTCTACTACACTCTGGTTTTTTCGCTTCTCGTCTTGGAGATGGGTCTCTTTATGCTCTTGGTTATGCCG
ATGCCGTTTAACGCTAAGCGCAGAGTCTTTACCTTCATCTCGGAAAACCCCCTGGTGGCCAAGGTTCAGTATTGG
ATGAAGATTACCTTTGTCTTTATCCTCATTCTCTTCCTTGACAGCGTCAATCGGGTCTATCGTGTTCAGATTGAG
CTCACGGCGTCTGCTGAAAACAAGGGCCCGACGATTATTGGTTCGGAGCGGCTCGAGGTGCAGGCTCGCAAGTTT
TACTCGCAGCGCAACATGTATCTTTGCGGCTTCACCCTCTTCCTATCCCTCATCCTCAACCGCACCTATGTCATG
ATTCTCGAAATGATGCGACTGGAGGACCGCCTCCGGACTTATGAGGGCACAAACAAGAACACCAAGGAGAGCGAG
AAGCTGGCCAATGCTGGCAAACCGGGCGAATTGGGCAAGCTGCGCGAGAAGCTGGCACAAAAGGAACGCGATCTC
GAGACGCTCAAGAAGCAGAGCGCACAGCTTCACAAGAGCTACGACGAGTTGACGGACAAGTATGCTGCCACACAA
AATTCTGGCGAGGCGCGCAAGGAAAAATAG
Gene >OphauG2|1636
ATGACGCTCTACTACACTCTGGTGTGTCTTTTTCTTCTTGTTGTTCGCCTTGTGTCGCAGCAACTAGCGAGAAGG
GGGGGAGGAGAGCCGGGTTGCTAACTGGGCTAGGTTTTTTCGCTTCTCGTCTTGGAGATGGGTCTCTTTATGCTC
TTGGTTATGCCGATGCCGTTTAACGCTAAGCGCAGAGTCTTTACGTACGTTTTTTTTTACGGCTGCTGATGCCTT
GTTGTTGCTGACACGAGGGCGGGCGTTTTTTTGGTAGCTTCATCTCGGAAAACCCCCTGGTGGCCAAGGTTCAGT
ATTGGATGAAGATTACCTTTGTCTTTATCCTCATTCTCTTCCTTGACAGCGTCAATCGGGTCTATCGTGTTCAGA
TTGAGCTCACGGCGTCTGCTGAAAACAAGGGGTAGGTTTCAAGCGACGCTGTATCCATTTCTTTATTACTCTCTA
ACCTTTTTTTTTTCTTGATTCACTTGTAGCCCGACGATTATTGGTTCGGAGCGGCTCGAGGTGCAGGCTCGCAAG
TTTTACTCGCAGCGCAACATGTATCTTTGCGGCTTCACCCTCTTCCTATCCCTCATCCTCAACCGCACCTATGTC
ATGATTCTCGAAATGATGCGACTGGAGGACCGCCTCCGGACTTATGAGGGCACAAACAAGAACACCAAGGAGAGC
GAGAAGCTGGCCAATGCTGGCAAACCGGGCGAATTGGGCAAGCTGCGCGAGAAGCTGGCACAAAAGGAACGCGAT
CTCGAGACGCTCAAGAAGCAGAGCGCACAGCTTCACAAGAGCTACGACGAGTTGACGGACAAGTATGCTGCCACA
CAAAATTCTGGCGAGGCGCGCAAGGAAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail