Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1634
Gene name
LocationContig_1502:1635..3016
Strand-
Gene length (bp)1381
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00551 Formyl_trans_N Formyl transferase 1.5E-21 45 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32785|FMT_YEAST Methionyl-tRNA formyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMT1 PE=1 SV=2 29 267 1.0E-28
sp|A5CF64|FMT_ORITB Methionyl-tRNA formyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=fmt PE=3 SV=1 44 282 7.0E-24
sp|A4WNU8|FMT_RHOS5 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=fmt PE=3 SV=1 44 282 2.0E-22
sp|B0BWL1|FMT_RICRO Methionyl-tRNA formyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=fmt PE=3 SV=1 44 290 2.0E-22
sp|C4K0Y8|FMT_RICPU Methionyl-tRNA formyltransferase OS=Rickettsia peacockii (strain Rustic) GN=fmt PE=3 SV=1 44 290 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32785|FMT_YEAST Methionyl-tRNA formyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMT1 PE=1 SV=2 29 267 1.0E-28
sp|A5CF64|FMT_ORITB Methionyl-tRNA formyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=fmt PE=3 SV=1 44 282 7.0E-24
sp|A4WNU8|FMT_RHOS5 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=fmt PE=3 SV=1 44 282 2.0E-22
sp|B0BWL1|FMT_RICRO Methionyl-tRNA formyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=fmt PE=3 SV=1 44 290 2.0E-22
sp|C4K0Y8|FMT_RICPU Methionyl-tRNA formyltransferase OS=Rickettsia peacockii (strain Rustic) GN=fmt PE=3 SV=1 44 290 3.0E-22
sp|O33582|FMT_RICTY Methionyl-tRNA formyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fmt PE=3 SV=2 44 290 3.0E-22
sp|Q2GFU1|FMT_EHRCR Methionyl-tRNA formyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=fmt PE=3 SV=1 44 257 5.0E-22
sp|O33523|FMT_RICFE Methionyl-tRNA formyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fmt PE=3 SV=2 44 290 7.0E-22
sp|P50932|FMT_RICPR Methionyl-tRNA formyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=fmt PE=3 SV=2 44 290 1.0E-21
sp|O33519|FMT_RICCN Methionyl-tRNA formyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fmt PE=3 SV=2 44 290 1.0E-21
sp|C3PMQ0|FMT_RICAE Methionyl-tRNA formyltransferase OS=Rickettsia africae (strain ESF-5) GN=fmt PE=3 SV=1 44 290 1.0E-21
sp|Q1RJ22|FMT_RICBR Methionyl-tRNA formyltransferase OS=Rickettsia bellii (strain RML369-C) GN=fmt PE=3 SV=1 44 265 2.0E-21
sp|A8F0W5|FMT_RICM5 Methionyl-tRNA formyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=fmt PE=3 SV=1 44 290 2.0E-21
sp|Q3IZH6|FMT_RHOS4 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=fmt PE=3 SV=1 44 277 3.0E-21
sp|B9KML7|FMT_RHOSK Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=fmt PE=3 SV=1 44 282 1.0E-20
sp|Q5LNI8|FMT_RUEPO Methionyl-tRNA formyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=fmt PE=3 SV=1 44 277 2.0E-20
sp|O33520|FMT_RICCK Methionyl-tRNA formyltransferase OS=Rickettsia canadensis (strain McKiel) GN=fmt PE=3 SV=2 44 286 3.0E-20
sp|A3PMS1|FMT_RHOS1 Methionyl-tRNA formyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=fmt PE=3 SV=1 44 282 3.0E-20
sp|Q3YSQ0|FMT_EHRCJ Methionyl-tRNA formyltransferase OS=Ehrlichia canis (strain Jake) GN=fmt PE=3 SV=1 44 257 6.0E-20
sp|A8LLC0|FMT_DINSH Methionyl-tRNA formyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=fmt PE=3 SV=1 44 277 6.0E-20
sp|A1AZR0|FMT_PARDP Methionyl-tRNA formyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=fmt PE=3 SV=1 44 277 8.0E-20
sp|Q1GDF7|FMT_RUEST Methionyl-tRNA formyltransferase OS=Ruegeria sp. (strain TM1040) GN=fmt PE=3 SV=1 44 286 2.0E-19
sp|Q5NPC5|FMT_ZYMMO Methionyl-tRNA formyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=fmt PE=3 SV=1 44 290 2.0E-19
sp|Q9UTG6|FMT_SCHPO Putative methionyl-tRNA formyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fmt1 PE=3 SV=1 43 318 4.0E-19
sp|Q6G1G8|FMT_BARQU Methionyl-tRNA formyltransferase OS=Bartonella quintana (strain Toulouse) GN=fmt PE=3 SV=1 44 267 2.0E-18
sp|O77480|FMT_BOVIN Methionyl-tRNA formyltransferase, mitochondrial OS=Bos taurus GN=MTFMT PE=1 SV=2 39 298 2.0E-18
sp|A9ILK1|FMT_BART1 Methionyl-tRNA formyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=fmt PE=3 SV=1 44 267 2.0E-18
sp|Q2SQX2|FMT_HAHCH Methionyl-tRNA formyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=fmt PE=3 SV=1 41 267 4.0E-18
sp|A1TWN0|FMT_MARHV Methionyl-tRNA formyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=fmt PE=3 SV=1 44 302 5.0E-18
sp|B6J655|FMT_COXB1 Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=fmt PE=3 SV=1 44 267 6.0E-18
sp|Q15ZY3|FMT_PSEA6 Methionyl-tRNA formyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=fmt PE=3 SV=1 44 289 7.0E-18
sp|Q9D799|FMT_MOUSE Methionyl-tRNA formyltransferase, mitochondrial OS=Mus musculus GN=Mtfmt PE=2 SV=3 39 265 9.0E-18
sp|Q9KVU4|FMT_VIBCH Methionyl-tRNA formyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fmt PE=1 SV=1 41 270 1.0E-17
sp|A5F4B4|FMT_VIBC3 Methionyl-tRNA formyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fmt PE=3 SV=1 41 270 1.0E-17
sp|Q83AA8|FMT_COXBU Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fmt PE=1 SV=1 44 267 1.0E-17
sp|A9N9H5|FMT_COXBR Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=fmt PE=3 SV=1 44 267 1.0E-17
sp|A9KH14|FMT_COXBN Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=fmt PE=3 SV=1 44 267 1.0E-17
sp|B6J3C2|FMT_COXB2 Methionyl-tRNA formyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=fmt PE=3 SV=1 44 267 1.0E-17
sp|C3LPB8|FMT_VIBCM Methionyl-tRNA formyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fmt PE=3 SV=1 41 265 1.0E-17
sp|Q5HBX2|FMT_EHRRW Methionyl-tRNA formyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=fmt PE=3 SV=1 44 249 1.0E-17
sp|A4XL81|FMT_CALS8 Methionyl-tRNA formyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=fmt PE=3 SV=1 44 328 1.0E-17
sp|Q820J7|FMT_NITEU Methionyl-tRNA formyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=fmt PE=3 SV=1 44 265 2.0E-17
sp|Q6LLJ2|FMT_PHOPR Methionyl-tRNA formyltransferase OS=Photobacterium profundum GN=fmt PE=3 SV=1 41 266 2.0E-17
sp|C3MF25|FMT_RHISN Methionyl-tRNA formyltransferase OS=Rhizobium sp. (strain NGR234) GN=fmt PE=3 SV=1 43 267 2.0E-17
sp|C4K6Y1|FMT_HAMD5 Methionyl-tRNA formyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=fmt PE=3 SV=1 41 265 2.0E-17
sp|Q5FFG4|FMT_EHRRG Methionyl-tRNA formyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=fmt PE=3 SV=1 44 249 2.0E-17
sp|Q92SH5|FMT_RHIME Methionyl-tRNA formyltransferase OS=Rhizobium meliloti (strain 1021) GN=fmt PE=3 SV=1 43 267 2.0E-17
sp|Q96DP5|FMT_HUMAN Methionyl-tRNA formyltransferase, mitochondrial OS=Homo sapiens GN=MTFMT PE=1 SV=2 12 301 3.0E-17
sp|Q16AL2|FMT_ROSDO Methionyl-tRNA formyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=fmt PE=3 SV=1 44 265 3.0E-17
sp|A7GRJ6|FMT_BACCN Methionyl-tRNA formyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=fmt PE=3 SV=1 44 292 3.0E-17
sp|A5VDM0|FMT_SPHWW Methionyl-tRNA formyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=fmt PE=3 SV=1 44 286 3.0E-17
sp|Q6G5F1|FMT_BARHE Methionyl-tRNA formyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=fmt PE=3 SV=1 44 267 4.0E-17
sp|Q6HEU9|FMT_BACHK Methionyl-tRNA formyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=fmt PE=3 SV=1 44 293 6.0E-17
sp|A6U5I5|FMT_SINMW Methionyl-tRNA formyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=fmt PE=3 SV=1 43 267 7.0E-17
sp|Q31J85|FMT_THICR Methionyl-tRNA formyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=fmt PE=3 SV=1 41 272 7.0E-17
sp|A3QJF5|FMT_SHELP Methionyl-tRNA formyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fmt PE=3 SV=1 43 275 9.0E-17
sp|Q28V76|FMT_JANSC Methionyl-tRNA formyltransferase OS=Jannaschia sp. (strain CCS1) GN=fmt PE=3 SV=1 44 265 1.0E-16
sp|A4SFP1|FMT_CHLPM Methionyl-tRNA formyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=fmt PE=3 SV=1 43 265 1.0E-16
sp|Q5I0C5|FMT_RAT Methionyl-tRNA formyltransferase, mitochondrial OS=Rattus norvegicus GN=Mtfmt PE=2 SV=1 39 265 1.0E-16
sp|Q8DDE4|FMT_VIBVU Methionyl-tRNA formyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=fmt PE=3 SV=1 41 265 1.0E-16
sp|B5ED77|FMT_GEOBB Methionyl-tRNA formyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=fmt PE=3 SV=1 44 267 1.0E-16
sp|Q2WAS9|FMT_MAGSA Methionyl-tRNA formyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=fmt PE=3 SV=1 44 304 2.0E-16
sp|O67890|FMT_AQUAE Methionyl-tRNA formyltransferase OS=Aquifex aeolicus (strain VF5) GN=fmt PE=3 SV=1 45 323 2.0E-16
sp|B9JQX1|FMT_AGRVS Methionyl-tRNA formyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=fmt PE=3 SV=1 44 300 2.0E-16
sp|Q7MGK5|FMT_VIBVY Methionyl-tRNA formyltransferase OS=Vibrio vulnificus (strain YJ016) GN=fmt PE=3 SV=1 41 265 2.0E-16
sp|B7HDY9|FMT_BACC4 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain B4264) GN=fmt PE=3 SV=1 44 293 2.0E-16
sp|B7IUM5|FMT_BACC2 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain G9842) GN=fmt PE=3 SV=1 44 293 2.0E-16
sp|A2RN27|FMT_LACLM Methionyl-tRNA formyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=fmt PE=3 SV=1 45 249 2.0E-16
sp|Q9CEE9|FMT_LACLA Methionyl-tRNA formyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=fmt PE=3 SV=1 45 249 3.0E-16
sp|Q0I0S3|FMT_SHESR Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain MR-7) GN=fmt PE=3 SV=1 43 270 3.0E-16
sp|Q5FPX2|FMT_GLUOX Methionyl-tRNA formyltransferase OS=Gluconobacter oxydans (strain 621H) GN=fmt PE=3 SV=1 44 292 3.0E-16
sp|A5FVK3|FMT_ACICJ Methionyl-tRNA formyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=fmt PE=3 SV=1 44 266 4.0E-16
sp|A1JRZ2|FMT_YERE8 Methionyl-tRNA formyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fmt PE=3 SV=1 41 266 4.0E-16
sp|Q819U1|FMT_BACCR Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=fmt PE=3 SV=1 44 293 5.0E-16
sp|Q636G0|FMT_BACCZ Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=fmt PE=3 SV=1 44 292 5.0E-16
sp|C1EP90|FMT_BACC3 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain 03BB102) GN=fmt PE=3 SV=1 44 292 5.0E-16
sp|B7JJV3|FMT_BACC0 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain AH820) GN=fmt PE=3 SV=1 44 292 5.0E-16
sp|Q81WH2|FMT_BACAN Methionyl-tRNA formyltransferase OS=Bacillus anthracis GN=fmt PE=1 SV=1 44 292 5.0E-16
sp|A0RHN9|FMT_BACAH Methionyl-tRNA formyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=fmt PE=3 SV=1 44 292 5.0E-16
sp|C3L761|FMT_BACAC Methionyl-tRNA formyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=fmt PE=3 SV=1 44 292 5.0E-16
sp|C3P637|FMT_BACAA Methionyl-tRNA formyltransferase OS=Bacillus anthracis (strain A0248) GN=fmt PE=3 SV=1 44 292 5.0E-16
sp|B9IVF5|FMT_BACCQ Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain Q1) GN=fmt PE=3 SV=1 44 292 6.0E-16
sp|B7HLJ9|FMT_BACC7 Methionyl-tRNA formyltransferase OS=Bacillus cereus (strain AH187) GN=fmt PE=3 SV=1 44 292 6.0E-16
sp|C4L7Y3|FMT_TOLAT Methionyl-tRNA formyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=fmt PE=3 SV=1 44 326 6.0E-16
sp|Q02WP8|FMT_LACLS Methionyl-tRNA formyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=fmt PE=3 SV=1 45 249 7.0E-16
sp|A7HPQ2|FMT_PARL1 Methionyl-tRNA formyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=fmt PE=3 SV=1 44 319 8.0E-16
sp|Q8NX18|FMT_STAAW Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain MW2) GN=fmt PE=3 SV=1 45 295 8.0E-16
sp|Q6G9Z7|FMT_STAAS Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=fmt PE=3 SV=1 45 295 8.0E-16
sp|A1V9B4|FMT_DESVV Methionyl-tRNA formyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=fmt PE=3 SV=1 40 267 9.0E-16
sp|Q5E1Q7|FMT_VIBF1 Methionyl-tRNA formyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fmt PE=3 SV=1 41 265 9.0E-16
sp|Q8ZLM6|FMT_SALTY Methionyl-tRNA formyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fmt PE=3 SV=3 41 287 9.0E-16
sp|B4TXB1|FMT_SALSV Methionyl-tRNA formyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|B5BGV4|FMT_SALPK Methionyl-tRNA formyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|C0PZV0|FMT_SALPC Methionyl-tRNA formyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|A9N8B2|FMT_SALPB Methionyl-tRNA formyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|Q5PIT7|FMT_SALPA Methionyl-tRNA formyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fmt PE=3 SV=3 41 287 9.0E-16
sp|B4SUQ9|FMT_SALNS Methionyl-tRNA formyltransferase OS=Salmonella newport (strain SL254) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|B4TJX8|FMT_SALHS Methionyl-tRNA formyltransferase OS=Salmonella heidelberg (strain SL476) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|Q57J63|FMT_SALCH Methionyl-tRNA formyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=fmt PE=3 SV=3 41 287 9.0E-16
sp|B5F7R4|FMT_SALA4 Methionyl-tRNA formyltransferase OS=Salmonella agona (strain SL483) GN=fmt PE=3 SV=1 41 287 9.0E-16
sp|Q0AJ02|FMT_NITEC Methionyl-tRNA formyltransferase OS=Nitrosomonas eutropha (strain C91) GN=fmt PE=3 SV=1 44 277 9.0E-16
sp|A9VTA4|FMT_BACWK Methionyl-tRNA formyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=fmt PE=3 SV=1 44 292 1.0E-15
sp|Q8RDM3|FMT_FUSNN Methionyl-tRNA formyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fmt PE=3 SV=2 44 267 1.0E-15
sp|A5ESQ6|FMT_BRASB Methionyl-tRNA formyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=fmt PE=3 SV=1 43 267 1.0E-15
sp|B3CLK1|FMT_WOLPP Methionyl-tRNA formyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=fmt PE=3 SV=1 44 256 1.0E-15
sp|B4F1L6|FMT_PROMH Methionyl-tRNA formyltransferase OS=Proteus mirabilis (strain HI4320) GN=fmt PE=3 SV=1 41 266 1.0E-15
sp|B1JJH7|FMT_YERPY Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|Q664V3|FMT_YERPS Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|A4TH22|FMT_YERPP Methionyl-tRNA formyltransferase OS=Yersinia pestis (strain Pestoides F) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|Q1CCX5|FMT_YERPN Methionyl-tRNA formyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|A9R926|FMT_YERPG Methionyl-tRNA formyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|Q8ZJ80|FMT_YERPE Methionyl-tRNA formyltransferase OS=Yersinia pestis GN=fmt PE=1 SV=1 41 265 1.0E-15
sp|B2K505|FMT_YERPB Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|Q1C2X8|FMT_YERPA Methionyl-tRNA formyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|A7FNK3|FMT_YERP3 Methionyl-tRNA formyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|Q7MYI1|FMT_PHOLL Methionyl-tRNA formyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|A7MPE8|FMT_CROS8 Methionyl-tRNA formyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fmt PE=3 SV=1 41 265 1.0E-15
sp|Q8Z1X0|FMT_SALTI Methionyl-tRNA formyltransferase OS=Salmonella typhi GN=fmt PE=3 SV=3 41 287 1.0E-15
sp|A0L3X7|FMT_MAGMM Methionyl-tRNA formyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=fmt PE=3 SV=1 45 267 1.0E-15
sp|Q725Q9|FMT_DESVH Methionyl-tRNA formyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=fmt PE=3 SV=1 40 267 2.0E-15
sp|Q5N0J8|FMT_SYNP6 Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=fmt PE=3 SV=1 44 265 2.0E-15
sp|Q31LC9|FMT_SYNE7 Methionyl-tRNA formyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=fmt PE=3 SV=1 44 265 2.0E-15
sp|Q1H4Y0|FMT_METFK Methionyl-tRNA formyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=fmt PE=3 SV=1 44 267 2.0E-15
sp|B5FCW7|FMT_VIBFM Methionyl-tRNA formyltransferase OS=Vibrio fischeri (strain MJ11) GN=fmt PE=3 SV=1 41 265 2.0E-15
sp|B2FIR3|FMT_STRMK Methionyl-tRNA formyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=fmt PE=3 SV=1 44 310 2.0E-15
sp|Q6F6P9|FMT_ACIAD Methionyl-tRNA formyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fmt PE=3 SV=1 44 277 3.0E-15
sp|B6JJP7|FMT_OLICO Methionyl-tRNA formyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=fmt PE=3 SV=1 43 267 3.0E-15
sp|Q3J6T9|FMT_NITOC Methionyl-tRNA formyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=fmt PE=3 SV=1 41 293 3.0E-15
sp|A6TEU1|FMT_KLEP7 Methionyl-tRNA formyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fmt PE=3 SV=1 41 287 4.0E-15
sp|Q2YXK0|FMT_STAAB Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=fmt PE=3 SV=1 45 295 4.0E-15
sp|Q6GHL9|FMT_STAAR Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=fmt PE=3 SV=1 45 295 5.0E-15
sp|P99127|FMT_STAAN Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain N315) GN=fmt PE=1 SV=1 45 295 5.0E-15
sp|P64136|FMT_STAAM Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fmt PE=3 SV=1 45 295 5.0E-15
sp|A5ISA1|FMT_STAA9 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain JH9) GN=fmt PE=3 SV=1 45 295 5.0E-15
sp|A6U135|FMT_STAA2 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain JH1) GN=fmt PE=3 SV=1 45 295 5.0E-15
sp|A7X1H4|FMT_STAA1 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=fmt PE=3 SV=1 45 295 5.0E-15
sp|Q87KD4|FMT_VIBPA Methionyl-tRNA formyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fmt PE=3 SV=1 41 265 5.0E-15
sp|Q603G2|FMT_METCA Methionyl-tRNA formyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=fmt PE=3 SV=1 44 298 5.0E-15
sp|A4YLC0|FMT_BRASO Methionyl-tRNA formyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=fmt PE=3 SV=1 43 267 5.0E-15
sp|A5GBL0|FMT_GEOUR Methionyl-tRNA formyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=fmt PE=3 SV=1 44 267 5.0E-15
sp|A8GYH2|FMT_SHEPA Methionyl-tRNA formyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fmt PE=3 SV=1 43 275 5.0E-15
sp|Q65JS5|FMT_BACLD Methionyl-tRNA formyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fmt PE=3 SV=1 45 267 7.0E-15
sp|Q47K50|FMT_DECAR Methionyl-tRNA formyltransferase OS=Dechloromonas aromatica (strain RCB) GN=fmt PE=3 SV=1 44 282 7.0E-15
sp|B5FJI3|FMT_SALDC Methionyl-tRNA formyltransferase OS=Salmonella dublin (strain CT_02021853) GN=fmt PE=3 SV=1 41 287 8.0E-15
sp|Q03RS3|FMT_LACBA Methionyl-tRNA formyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=fmt PE=3 SV=1 46 200 8.0E-15
sp|Q92AI5|FMT_LISIN Methionyl-tRNA formyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=fmt PE=3 SV=1 45 267 9.0E-15
sp|Q9K9Y6|FMT_BACHD Methionyl-tRNA formyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=fmt PE=3 SV=1 44 267 1.0E-14
sp|A4ST58|FMT_AERS4 Methionyl-tRNA formyltransferase OS=Aeromonas salmonicida (strain A449) GN=fmt PE=3 SV=1 44 286 1.0E-14
sp|Q0HPA7|FMT_SHESM Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain MR-4) GN=fmt PE=3 SV=1 43 270 1.0E-14
sp|A8FP74|FMT_SHESH Methionyl-tRNA formyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=fmt PE=3 SV=1 43 275 1.0E-14
sp|B5R1E4|FMT_SALEP Methionyl-tRNA formyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=fmt PE=3 SV=1 41 266 1.0E-14
sp|B5RH48|FMT_SALG2 Methionyl-tRNA formyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fmt PE=3 SV=1 41 266 1.0E-14
sp|A1UUB5|FMT_BARBK Methionyl-tRNA formyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=fmt PE=3 SV=1 44 267 1.0E-14
sp|A0KR60|FMT_SHESA Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain ANA-3) GN=fmt PE=3 SV=1 43 270 1.0E-14
sp|B0BRR3|FMT_ACTPJ Methionyl-tRNA formyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=fmt PE=3 SV=1 44 265 1.0E-14
sp|B3GYS0|FMT_ACTP7 Methionyl-tRNA formyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=fmt PE=3 SV=1 44 265 1.0E-14
sp|A6VKJ6|FMT_ACTSZ Methionyl-tRNA formyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=fmt PE=3 SV=1 44 302 2.0E-14
sp|A3N2N5|FMT_ACTP2 Methionyl-tRNA formyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=fmt PE=3 SV=1 44 265 2.0E-14
sp|Q0VTE2|FMT_ALCBS Methionyl-tRNA formyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=fmt PE=3 SV=1 43 282 2.0E-14
sp|Q576T0|FMT_BRUAB Methionyl-tRNA formyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|Q2YJQ3|FMT_BRUA2 Methionyl-tRNA formyltransferase OS=Brucella abortus (strain 2308) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|B2SC20|FMT_BRUA1 Methionyl-tRNA formyltransferase OS=Brucella abortus (strain S19) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|B3EAP0|FMT_GEOLS Methionyl-tRNA formyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=fmt PE=3 SV=1 45 267 2.0E-14
sp|P64133|FMT_BRUSU Methionyl-tRNA formyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|P64132|FMT_BRUME Methionyl-tRNA formyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|A9MCV9|FMT_BRUC2 Methionyl-tRNA formyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|B5XNC3|FMT_KLEP3 Methionyl-tRNA formyltransferase OS=Klebsiella pneumoniae (strain 342) GN=fmt PE=3 SV=1 41 287 2.0E-14
sp|Q89BP0|FMT_BRADU Methionyl-tRNA formyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=fmt PE=3 SV=1 43 267 2.0E-14
sp|C0RMH3|FMT_BRUMB Methionyl-tRNA formyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|B8D822|FMT_BUCAT Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=fmt PE=3 SV=1 44 265 2.0E-14
sp|P57564|FMT_BUCAI Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fmt PE=3 SV=1 44 265 2.0E-14
sp|B8D9S0|FMT_BUCA5 Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=fmt PE=3 SV=1 44 265 2.0E-14
sp|B4SKH6|FMT_STRM5 Methionyl-tRNA formyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=fmt PE=3 SV=1 44 265 2.0E-14
sp|Q8EKQ9|FMT_SHEON Methionyl-tRNA formyltransferase OS=Shewanella oneidensis (strain MR-1) GN=fmt PE=3 SV=1 43 270 2.0E-14
sp|A8Z3Q2|FMT_STAAT Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=fmt PE=3 SV=1 45 295 2.0E-14
sp|A6QGB6|FMT_STAAE Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain Newman) GN=fmt PE=3 SV=1 45 295 2.0E-14
sp|Q5HGL6|FMT_STAAC Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain COL) GN=fmt PE=3 SV=1 45 295 2.0E-14
sp|Q2FZ68|FMT_STAA8 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=fmt PE=3 SV=1 45 295 2.0E-14
sp|Q2FHM2|FMT_STAA3 Methionyl-tRNA formyltransferase OS=Staphylococcus aureus (strain USA300) GN=fmt PE=3 SV=1 45 295 2.0E-14
sp|A9WW44|FMT_BRUSI Methionyl-tRNA formyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|B9M2D5|FMT_GEODF Methionyl-tRNA formyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=fmt PE=3 SV=1 44 267 2.0E-14
sp|Q2GJB8|FMT_ANAPZ Methionyl-tRNA formyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=fmt PE=3 SV=1 44 229 2.0E-14
sp|B0VAE0|FMT_ACIBY Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain AYE) GN=fmt PE=3 SV=1 44 277 2.0E-14
sp|A3MAA1|FMT_ACIBT Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=fmt PE=3 SV=2 44 277 2.0E-14
sp|B7GUZ7|FMT_ACIB3 Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=fmt PE=3 SV=1 44 277 2.0E-14
sp|Q8ER25|FMT_OCEIH Methionyl-tRNA formyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=fmt PE=3 SV=1 45 267 2.0E-14
sp|B7I2C3|FMT_ACIB5 Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=fmt PE=3 SV=1 44 277 3.0E-14
sp|B8DDS9|FMT_LISMH Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=fmt PE=3 SV=1 45 267 3.0E-14
sp|Q71YJ3|FMT_LISMF Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=fmt PE=3 SV=1 45 267 3.0E-14
sp|C1KWC2|FMT_LISMC Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=fmt PE=3 SV=1 45 267 3.0E-14
sp|Q2NQQ3|FMT_SODGM Methionyl-tRNA formyltransferase OS=Sodalis glossinidius (strain morsitans) GN=fmt PE=3 SV=1 41 265 3.0E-14
sp|A5VVU0|FMT_BRUO2 Methionyl-tRNA formyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=fmt PE=3 SV=1 44 267 3.0E-14
sp|B2I2H7|FMT_ACIBC Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=fmt PE=3 SV=1 44 277 3.0E-14
sp|Q2G493|FMT_NOVAD Methionyl-tRNA formyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=fmt PE=3 SV=1 44 303 3.0E-14
sp|Q74GW4|FMT_GEOSL Methionyl-tRNA formyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=fmt PE=3 SV=1 44 267 3.0E-14
sp|B1XW99|FMT_LEPCP Methionyl-tRNA formyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=fmt PE=3 SV=1 44 266 4.0E-14
sp|B2A2K2|FMT_NATTJ Methionyl-tRNA formyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=fmt PE=3 SV=1 44 292 4.0E-14
sp|Q9RRQ3|FMT_DEIRA Methionyl-tRNA formyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=fmt PE=3 SV=1 45 283 4.0E-14
sp|B0VQ12|FMT_ACIBS Methionyl-tRNA formyltransferase OS=Acinetobacter baumannii (strain SDF) GN=fmt PE=3 SV=1 44 277 4.0E-14
sp|B7VMX2|FMT_VIBTL Methionyl-tRNA formyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=fmt PE=3 SV=1 41 265 4.0E-14
sp|B3QCH2|FMT_RHOPT Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=fmt PE=3 SV=1 43 267 4.0E-14
sp|B8F7U6|FMT_HAEPS Methionyl-tRNA formyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=fmt PE=3 SV=1 44 265 5.0E-14
sp|C5D8R6|FMT_GEOSW Methionyl-tRNA formyltransferase OS=Geobacillus sp. (strain WCH70) GN=fmt PE=3 SV=1 44 267 5.0E-14
sp|A9KUA1|FMT_SHEB9 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS195) GN=fmt PE=3 SV=1 43 275 6.0E-14
sp|B1LGP4|FMT_ECOSM Methionyl-tRNA formyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fmt PE=3 SV=1 41 287 6.0E-14
sp|A6WYK8|FMT_OCHA4 Methionyl-tRNA formyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=fmt PE=3 SV=1 44 267 6.0E-14
sp|B2U2Q5|FMT_SHIB3 Methionyl-tRNA formyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fmt PE=3 SV=1 41 287 6.0E-14
sp|A4VFH7|FMT_PSEU5 Methionyl-tRNA formyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=fmt PE=3 SV=1 41 267 7.0E-14
sp|B8CHB1|FMT_SHEPW Methionyl-tRNA formyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fmt PE=3 SV=1 43 275 7.0E-14
sp|B1KCW3|FMT_SHEWM Methionyl-tRNA formyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fmt PE=3 SV=1 43 275 7.0E-14
sp|A7N122|FMT_VIBCB Methionyl-tRNA formyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fmt PE=3 SV=1 41 184 8.0E-14
sp|C6DFR6|FMT_PECCP Methionyl-tRNA formyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fmt PE=3 SV=1 41 265 8.0E-14
sp|Q67PR4|FMT_SYMTH Methionyl-tRNA formyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=fmt PE=3 SV=1 44 290 1.0E-13
sp|A8GKG6|FMT_SERP5 Methionyl-tRNA formyltransferase OS=Serratia proteamaculans (strain 568) GN=fmt PE=3 SV=1 41 265 1.0E-13
sp|Q31VY9|FMT_SHIBS Methionyl-tRNA formyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|Q08A29|FMT_SHEFN Methionyl-tRNA formyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=fmt PE=3 SV=1 43 267 1.0E-13
sp|C0QUK8|FMT_PERMH Methionyl-tRNA formyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=fmt PE=3 SV=1 44 267 1.0E-13
sp|B6I201|FMT_ECOSE Methionyl-tRNA formyltransferase OS=Escherichia coli (strain SE11) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|Q1LT57|FMT_BAUCH Methionyl-tRNA formyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=fmt PE=3 SV=1 44 265 1.0E-13
sp|A6WHB0|FMT_SHEB8 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS185) GN=fmt PE=3 SV=1 43 275 1.0E-13
sp|Q4FNG0|FMT_PELUB Methionyl-tRNA formyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=fmt PE=3 SV=1 45 265 1.0E-13
sp|Q3YWX2|FMT_SHISS Methionyl-tRNA formyltransferase OS=Shigella sonnei (strain Ss046) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|A3CYK4|FMT_SHEB5 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fmt PE=3 SV=1 43 275 1.0E-13
sp|C5CG19|FMT_KOSOT Methionyl-tRNA formyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=fmt PE=3 SV=1 44 306 1.0E-13
sp|B7NLK7|FMT_ECO7I Methionyl-tRNA formyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|C4ZEV8|FMT_EUBR3 Methionyl-tRNA formyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=fmt PE=3 SV=1 44 292 1.0E-13
sp|P23882|FMT_ECOLI Methionyl-tRNA formyltransferase OS=Escherichia coli (strain K12) GN=fmt PE=1 SV=4 41 287 1.0E-13
sp|B1IQ12|FMT_ECOLC Methionyl-tRNA formyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|A8A592|FMT_ECOHS Methionyl-tRNA formyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|B1X6E0|FMT_ECODH Methionyl-tRNA formyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|C4ZUE2|FMT_ECOBW Methionyl-tRNA formyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|Q65QF1|FMT_MANSM Methionyl-tRNA formyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fmt PE=3 SV=2 43 185 1.0E-13
sp|Q83PZ0|FMT_SHIFL Methionyl-tRNA formyltransferase OS=Shigella flexneri GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|Q0T015|FMT_SHIF8 Methionyl-tRNA formyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=fmt PE=3 SV=1 41 287 1.0E-13
sp|B8E3S3|FMT_SHEB2 Methionyl-tRNA formyltransferase OS=Shewanella baltica (strain OS223) GN=fmt PE=3 SV=1 43 275 1.0E-13
sp|Q82ZD8|FMT_ENTFA Methionyl-tRNA formyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=fmt PE=3 SV=1 125 277 2.0E-13
sp|B7LRQ4|FMT_ESCF3 Methionyl-tRNA formyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|B7LHY8|FMT_ECO55 Methionyl-tRNA formyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|B7UK11|FMT_ECO27 Methionyl-tRNA formyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|A1SR38|FMT_PSYIN Methionyl-tRNA formyltransferase OS=Psychromonas ingrahamii (strain 37) GN=fmt PE=3 SV=1 42 267 2.0E-13
sp|Q32B62|FMT_SHIDS Methionyl-tRNA formyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|B5YT07|FMT_ECO5E Methionyl-tRNA formyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|Q8X8F1|FMT_ECO57 Methionyl-tRNA formyltransferase OS=Escherichia coli O157:H7 GN=fmt PE=3 SV=3 41 287 2.0E-13
sp|Q11LC8|FMT_CHESB Methionyl-tRNA formyltransferase OS=Chelativorans sp. (strain BNC1) GN=fmt PE=3 SV=1 44 267 2.0E-13
sp|Q8FD13|FMT_ECOL6 Methionyl-tRNA formyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fmt PE=3 SV=3 41 287 2.0E-13
sp|A9HKQ4|FMT_GLUDA Methionyl-tRNA formyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=fmt PE=3 SV=1 44 298 2.0E-13
sp|B7M0Z3|FMT_ECO8A Methionyl-tRNA formyltransferase OS=Escherichia coli O8 (strain IAI1) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|A7ZSH6|FMT_ECO24 Methionyl-tRNA formyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|A4IM47|FMT_GEOTN Methionyl-tRNA formyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=fmt PE=3 SV=1 45 267 2.0E-13
sp|B7NDQ9|FMT_ECOLU Methionyl-tRNA formyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|Q9PEV1|FMT_XYLFA Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=fmt PE=3 SV=1 44 265 2.0E-13
sp|Q48AS9|FMT_COLP3 Methionyl-tRNA formyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fmt PE=3 SV=1 43 265 2.0E-13
sp|P57949|FMT_PASMU Methionyl-tRNA formyltransferase OS=Pasteurella multocida (strain Pm70) GN=fmt PE=3 SV=1 44 185 2.0E-13
sp|A7Z4J3|FMT_BACMF Methionyl-tRNA formyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=fmt PE=3 SV=1 45 292 2.0E-13
sp|A3CPX4|FMT_STRSV Methionyl-tRNA formyltransferase OS=Streptococcus sanguinis (strain SK36) GN=fmt PE=3 SV=1 44 267 2.0E-13
sp|Q1R645|FMT_ECOUT Methionyl-tRNA formyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|A1AGH9|FMT_ECOK1 Methionyl-tRNA formyltransferase OS=Escherichia coli O1:K1 / APEC GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|B7N172|FMT_ECO81 Methionyl-tRNA formyltransferase OS=Escherichia coli O81 (strain ED1a) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|B7MCQ3|FMT_ECO45 Methionyl-tRNA formyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fmt PE=3 SV=1 41 287 2.0E-13
sp|Q8P4G0|FMT_XANCP Methionyl-tRNA formyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=fmt PE=3 SV=1 44 282 3.0E-13
sp|Q4UQ15|FMT_XANC8 Methionyl-tRNA formyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=fmt PE=3 SV=1 44 282 3.0E-13
sp|Q8Y676|FMT_LISMO Methionyl-tRNA formyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=fmt PE=3 SV=1 45 267 3.0E-13
sp|Q5L0S3|FMT_GEOKA Methionyl-tRNA formyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=fmt PE=3 SV=1 46 267 3.0E-13
sp|A5UEB3|FMT_HAEIE Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain PittEE) GN=fmt PE=3 SV=1 44 302 3.0E-13
sp|Q0AXL4|FMT_SYNWW Methionyl-tRNA formyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=fmt PE=3 SV=1 44 267 3.0E-13
sp|A1WZH3|FMT_HALHL Methionyl-tRNA formyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=fmt PE=3 SV=1 45 334 3.0E-13
sp|A1RDX6|FMT_SHESW Methionyl-tRNA formyltransferase OS=Shewanella sp. (strain W3-18-1) GN=fmt PE=3 SV=1 44 275 3.0E-13
sp|Q5WFK7|FMT_BACSK Methionyl-tRNA formyltransferase OS=Bacillus clausii (strain KSM-K16) GN=fmt PE=3 SV=1 44 225 3.0E-13
sp|Q88B42|FMT_PSESM Methionyl-tRNA formyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fmt PE=3 SV=1 41 267 3.0E-13
sp|Q73GR6|FMT_WOLPM Methionyl-tRNA formyltransferase OS=Wolbachia pipientis wMel GN=fmt PE=3 SV=1 44 231 3.0E-13
sp|Q5P4H6|FMT_AROAE Methionyl-tRNA formyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=fmt PE=3 SV=1 41 265 3.0E-13
sp|Q5HPX5|FMT_STAEQ Methionyl-tRNA formyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fmt PE=3 SV=1 45 265 3.0E-13
sp|Q03FY3|FMT_PEDPA Methionyl-tRNA formyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=fmt PE=3 SV=1 46 200 4.0E-13
sp|A9B2Z9|FMT_HERA2 Methionyl-tRNA formyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=fmt PE=3 SV=1 44 265 4.0E-13
sp|A0KEW9|FMT_AERHH Methionyl-tRNA formyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fmt PE=3 SV=1 42 266 5.0E-13
sp|Q6NC50|FMT_RHOPA Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=fmt PE=3 SV=1 43 267 5.0E-13
sp|B9EB94|FMT_MACCJ Methionyl-tRNA formyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=fmt PE=3 SV=1 45 265 5.0E-13
sp|Q3IDI3|FMT_PSEHT Methionyl-tRNA formyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=fmt PE=3 SV=1 41 293 5.0E-13
sp|Q5M3I7|FMT_STRT2 Methionyl-tRNA formyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=fmt PE=3 SV=1 45 229 5.0E-13
sp|Q5LYX4|FMT_STRT1 Methionyl-tRNA formyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=fmt PE=3 SV=1 45 229 5.0E-13
sp|Q6MJL7|FMT_BDEBA Methionyl-tRNA formyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=fmt PE=3 SV=1 44 277 6.0E-13
sp|Q3BNK7|FMT_XANC5 Methionyl-tRNA formyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=fmt PE=3 SV=1 44 282 6.0E-13
sp|Q87AR0|FMT_XYLFT Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=fmt PE=3 SV=1 44 267 6.0E-13
sp|B2I8S3|FMT_XYLF2 Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain M23) GN=fmt PE=3 SV=1 44 267 6.0E-13
sp|Q8UID0|FMT_AGRFC Methionyl-tRNA formyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fmt PE=3 SV=1 44 267 6.0E-13
sp|A4Y1C6|FMT_SHEPC Methionyl-tRNA formyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fmt PE=3 SV=1 44 275 8.0E-13
sp|Q6D001|FMT_PECAS Methionyl-tRNA formyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fmt PE=3 SV=1 41 265 8.0E-13
sp|B0U4M3|FMT_XYLFM Methionyl-tRNA formyltransferase OS=Xylella fastidiosa (strain M12) GN=fmt PE=3 SV=1 44 265 9.0E-13
sp|Q0BUB3|FMT_GRABC Methionyl-tRNA formyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=fmt PE=3 SV=1 44 307 9.0E-13
sp|Q88WL3|FMT_LACPL Methionyl-tRNA formyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=fmt PE=3 SV=1 46 248 9.0E-13
sp|C0R3S7|FMT_WOLWR Methionyl-tRNA formyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=fmt PE=3 SV=1 44 231 9.0E-13
sp|A4WF96|FMT_ENT38 Methionyl-tRNA formyltransferase OS=Enterobacter sp. (strain 638) GN=fmt PE=3 SV=1 41 287 9.0E-13
sp|Q38XT6|FMT_LACSS Methionyl-tRNA formyltransferase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=fmt PE=3 SV=1 46 200 9.0E-13
sp|B5Y7I0|FMT_COPPD Methionyl-tRNA formyltransferase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=fmt PE=3 SV=1 44 196 1.0E-12
sp|B9LFJ4|FMT_CHLSY Methionyl-tRNA formyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=fmt PE=3 SV=1 44 266 1.0E-12
sp|A9WAR0|FMT_CHLAA Methionyl-tRNA formyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=fmt PE=3 SV=1 44 266 1.0E-12
sp|Q5H5D0|FMT_XANOR Methionyl-tRNA formyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=fmt PE=3 SV=2 44 282 1.0E-12
sp|B2SL54|FMT_XANOP Methionyl-tRNA formyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=fmt PE=3 SV=1 44 282 1.0E-12
sp|Q2P825|FMT_XANOM Methionyl-tRNA formyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=fmt PE=3 SV=1 44 282 1.0E-12
sp|A0AJS8|FMT_LISW6 Methionyl-tRNA formyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=fmt PE=3 SV=1 45 267 1.0E-12
sp|Q8CSW1|FMT_STAES Methionyl-tRNA formyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fmt PE=3 SV=1 45 229 1.0E-12
sp|Q500T0|FMT_PSEU2 Methionyl-tRNA formyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fmt PE=3 SV=1 41 267 1.0E-12
sp|B8E0X6|FMT_DICTD Methionyl-tRNA formyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=fmt PE=3 SV=1 44 265 1.0E-12
sp|Q0I182|FMT_HAES1 Methionyl-tRNA formyltransferase OS=Haemophilus somnus (strain 129Pt) GN=fmt PE=3 SV=1 43 306 1.0E-12
sp|B8CWS7|FMT_HALOH Methionyl-tRNA formyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=fmt PE=3 SV=1 44 194 1.0E-12
sp|Q17Y87|FMT_HELAH Methionyl-tRNA formyltransferase OS=Helicobacter acinonychis (strain Sheeba) GN=fmt PE=3 SV=1 44 295 1.0E-12
sp|Q12TA6|FMT_SHEDO Methionyl-tRNA formyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=fmt PE=3 SV=1 43 229 2.0E-12
sp|A8FD38|FMT_BACP2 Methionyl-tRNA formyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=fmt PE=3 SV=1 45 291 2.0E-12
sp|Q3SN28|FMT_NITWN Methionyl-tRNA formyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=fmt PE=3 SV=1 43 267 2.0E-12
sp|Q0TCH4|FMT_ECOL5 Methionyl-tRNA formyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fmt PE=3 SV=1 41 287 2.0E-12
sp|B1HQE4|FMT_LYSSC Methionyl-tRNA formyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=fmt PE=3 SV=1 46 270 2.0E-12
sp|P94463|FMT_BACSU Methionyl-tRNA formyltransferase OS=Bacillus subtilis (strain 168) GN=fmt PE=3 SV=2 45 292 2.0E-12
sp|B0JY70|FMT_MICAN Methionyl-tRNA formyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=fmt PE=3 SV=1 44 265 2.0E-12
sp|Q5PBC7|FMT_ANAMM Methionyl-tRNA formyltransferase OS=Anaplasma marginale (strain St. Maries) GN=fmt PE=3 SV=1 44 229 2.0E-12
sp|Q6AQ97|FMT_DESPS Methionyl-tRNA formyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=fmt PE=3 SV=1 44 270 2.0E-12
sp|B8IFQ3|FMT_METNO Methionyl-tRNA formyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=fmt PE=3 SV=1 43 267 2.0E-12
sp|Q6MTF8|FMT_MYCMS Methionyl-tRNA formyltransferase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=fmt PE=3 SV=1 42 191 2.0E-12
sp|B0UWZ4|FMT_HISS2 Methionyl-tRNA formyltransferase OS=Histophilus somni (strain 2336) GN=fmt PE=3 SV=1 43 306 2.0E-12
sp|Q4KKR0|FMT_PSEF5 Methionyl-tRNA formyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fmt PE=3 SV=1 41 267 2.0E-12
sp|Q8K974|FMT_BUCAP Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fmt PE=3 SV=1 44 265 2.0E-12
sp|Q8PG21|FMT_XANAC Methionyl-tRNA formyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=fmt PE=3 SV=1 44 282 2.0E-12
sp|Q2SRX1|FMT_MYCCT Methionyl-tRNA formyltransferase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=fmt PE=3 SV=1 42 191 2.0E-12
sp|A2SCF7|FMT_METPP Methionyl-tRNA formyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=fmt PE=3 SV=1 44 267 2.0E-12
sp|A1S1J8|FMT_SHEAM Methionyl-tRNA formyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fmt PE=3 SV=1 43 200 3.0E-12
sp|B0T1S7|FMT_CAUSK Methionyl-tRNA formyltransferase OS=Caulobacter sp. (strain K31) GN=fmt PE=3 SV=1 44 305 3.0E-12
sp|B0TLC9|FMT_SHEHH Methionyl-tRNA formyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=fmt PE=3 SV=1 43 270 3.0E-12
sp|Q7UHZ6|FMT_RHOBA Methionyl-tRNA formyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=fmt PE=3 SV=1 38 266 3.0E-12
sp|B9J8C6|FMT_AGRRK Methionyl-tRNA formyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=fmt PE=3 SV=1 44 267 4.0E-12
sp|A9FL08|FMT_SORC5 Methionyl-tRNA formyltransferase OS=Sorangium cellulosum (strain So ce56) GN=fmt PE=3 SV=1 44 267 4.0E-12
sp|B4RDU2|FMT_PHEZH Methionyl-tRNA formyltransferase OS=Phenylobacterium zucineum (strain HLK1) GN=fmt PE=3 SV=1 44 286 4.0E-12
sp|Q7VK98|FMT_HAEDU Methionyl-tRNA formyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=fmt PE=3 SV=1 44 184 4.0E-12
sp|B4U5Z8|FMT_HYDS0 Methionyl-tRNA formyltransferase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=fmt PE=3 SV=1 44 225 4.0E-12
sp|A5V070|FMT_ROSS1 Methionyl-tRNA formyltransferase OS=Roseiflexus sp. (strain RS-1) GN=fmt PE=3 SV=1 43 267 4.0E-12
sp|A5UH91|FMT_HAEIG Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain PittGG) GN=fmt PE=3 SV=1 44 194 4.0E-12
sp|Q7MTE3|FMT_PORGI Methionyl-tRNA formyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=fmt PE=3 SV=1 40 267 5.0E-12
sp|Q48QI2|FMT_PSE14 Methionyl-tRNA formyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fmt PE=3 SV=1 41 267 5.0E-12
sp|A8AVV3|FMT_STRGC Methionyl-tRNA formyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=fmt PE=3 SV=1 45 229 6.0E-12
sp|Q8R9T1|FMT_CALS4 Methionyl-tRNA formyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=fmt PE=3 SV=1 44 265 6.0E-12
sp|P44787|FMT_HAEIN Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fmt PE=3 SV=1 44 194 6.0E-12
sp|A4J579|FMT_DESRM Methionyl-tRNA formyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=fmt PE=3 SV=1 44 229 7.0E-12
sp|B5YF45|FMT_DICT6 Methionyl-tRNA formyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=fmt PE=3 SV=1 44 265 7.0E-12
sp|Q9ABE9|FMT_CAUCR Methionyl-tRNA formyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=fmt PE=3 SV=1 44 315 8.0E-12
sp|B8GYF1|FMT_CAUCN Methionyl-tRNA formyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=fmt PE=3 SV=1 44 315 8.0E-12
sp|Q493I2|FMT_BLOPB Methionyl-tRNA formyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=fmt PE=3 SV=1 123 265 8.0E-12
sp|B0TGS9|FMT_HELMI Methionyl-tRNA formyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=fmt PE=3 SV=1 44 266 9.0E-12
sp|B2RM92|FMT_PORG3 Methionyl-tRNA formyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=fmt PE=3 SV=1 40 267 9.0E-12
sp|B6IPI1|FMT_RHOCS Methionyl-tRNA formyltransferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=fmt PE=3 SV=1 44 290 9.0E-12
sp|B0UP41|FMT_METS4 Methionyl-tRNA formyltransferase OS=Methylobacterium sp. (strain 4-46) GN=fmt PE=3 SV=1 44 265 1.0E-11
sp|B5ZN20|FMT_RHILW Methionyl-tRNA formyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=fmt PE=3 SV=1 44 267 1.0E-11
sp|Q7NQ76|FMT_CHRVO Methionyl-tRNA formyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=fmt PE=3 SV=1 44 266 1.0E-11
sp|B9DPM5|FMT_STACT Methionyl-tRNA formyltransferase OS=Staphylococcus carnosus (strain TM300) GN=fmt PE=3 SV=1 45 267 1.0E-11
sp|B2VK94|FMT_ERWT9 Methionyl-tRNA formyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=fmt PE=3 SV=1 41 266 1.0E-11
sp|Q2KD50|FMT_RHIEC Methionyl-tRNA formyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fmt PE=3 SV=1 44 267 2.0E-11
sp|A5D1B9|FMT_PELTS Methionyl-tRNA formyltransferase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=fmt PE=3 SV=1 44 229 2.0E-11
sp|B3PZF7|FMT_RHIE6 Methionyl-tRNA formyltransferase OS=Rhizobium etli (strain CIAT 652) GN=fmt PE=3 SV=1 44 267 2.0E-11
sp|A5EWL9|FMT_DICNV Methionyl-tRNA formyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=fmt PE=3 SV=1 45 265 2.0E-11
sp|Q13F19|FMT_RHOPS Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=fmt PE=3 SV=1 43 267 2.0E-11
sp|Q3KKE6|FMT_PSEPF Methionyl-tRNA formyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=fmt PE=3 SV=1 41 267 2.0E-11
sp|Q5QXI6|FMT_IDILO Methionyl-tRNA formyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fmt PE=3 SV=1 44 267 2.0E-11
sp|Q5XAP4|FMT_STRP6 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fmt PE=3 SV=1 44 229 2.0E-11
sp|Q1QTJ4|FMT_CHRSD Methionyl-tRNA formyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=fmt PE=3 SV=1 41 292 2.0E-11
sp|A4XNB2|FMT_PSEMY Methionyl-tRNA formyltransferase OS=Pseudomonas mendocina (strain ymp) GN=fmt PE=3 SV=1 42 267 2.0E-11
sp|B2V969|FMT_SULSY Methionyl-tRNA formyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fmt PE=3 SV=1 44 343 2.0E-11
sp|Q1IH35|FMT_PSEE4 Methionyl-tRNA formyltransferase OS=Pseudomonas entomophila (strain L48) GN=fmt PE=3 SV=1 44 265 3.0E-11
sp|Q2LRX4|FMT_SYNAS Methionyl-tRNA formyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=fmt PE=3 SV=1 44 267 3.0E-11
sp|Q2J2C5|FMT_RHOP2 Methionyl-tRNA formyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=fmt PE=3 SV=1 43 267 3.0E-11
sp|A4T0M5|FMT_POLSQ Methionyl-tRNA formyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=fmt PE=3 SV=1 44 282 3.0E-11
sp|B5YIL6|FMT_THEYD Methionyl-tRNA formyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=fmt PE=3 SV=1 46 265 3.0E-11
sp|B0KF29|FMT_PSEPG Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain GB-1) GN=fmt PE=3 SV=1 44 267 3.0E-11
sp|Q1J5I9|FMT_STRPF Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=fmt PE=3 SV=1 44 229 3.0E-11
sp|Q8P003|FMT_STRP8 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fmt PE=3 SV=1 44 229 3.0E-11
sp|Q049P0|FMT_LACDB Methionyl-tRNA formyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=fmt PE=3 SV=1 46 229 3.0E-11
sp|A2RD70|FMT_STRPG Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q1JKP9|FMT_STRPC Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q1JAJ7|FMT_STRPB Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q48S21|FMT_STRPM Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q1GWK0|FMT_SPHAL Methionyl-tRNA formyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=fmt PE=3 SV=1 44 265 4.0E-11
sp|A8MH85|FMT_ALKOO Methionyl-tRNA formyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=fmt PE=3 SV=1 44 184 4.0E-11
sp|Q99YM7|FMT_STRP1 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M1 GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q98D53|FMT_RHILO Methionyl-tRNA formyltransferase OS=Rhizobium loti (strain MAFF303099) GN=fmt PE=3 SV=1 43 267 4.0E-11
sp|B5XMI3|FMT_STRPZ Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q9JWY9|FMT_NEIMA Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fmt PE=3 SV=1 125 286 4.0E-11
sp|B9DV45|FMT_STRU0 Methionyl-tRNA formyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=fmt PE=3 SV=1 45 229 4.0E-11
sp|P0DB05|FMT_STRPQ Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|P0DB04|FMT_STRP3 Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fmt PE=3 SV=1 44 229 4.0E-11
sp|Q9K1K6|FMT_NEIMB Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=fmt PE=3 SV=1 125 286 4.0E-11
sp|A7NNY4|FMT_ROSCS Methionyl-tRNA formyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=fmt PE=3 SV=1 44 229 5.0E-11
sp|Q7VQC1|FMT_BLOFL Methionyl-tRNA formyltransferase OS=Blochmannia floridanus GN=fmt PE=3 SV=1 123 321 5.0E-11
sp|Q39QC2|FMT_GEOMG Methionyl-tRNA formyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=fmt PE=3 SV=1 44 267 5.0E-11
sp|C5BF18|FMT_EDWI9 Methionyl-tRNA formyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=fmt PE=3 SV=1 41 265 5.0E-11
sp|Q3Z614|FMT_DEHM1 Methionyl-tRNA formyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=fmt PE=3 SV=1 44 291 5.0E-11
sp|B1J432|FMT_PSEPW Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain W619) GN=fmt PE=3 SV=1 44 267 5.0E-11
sp|B9MI87|FMT_ACIET Methionyl-tRNA formyltransferase OS=Acidovorax ebreus (strain TPSY) GN=fmt PE=3 SV=1 125 265 5.0E-11
sp|Q1AVZ9|FMT_RUBXD Methionyl-tRNA formyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=fmt PE=3 SV=1 44 267 5.0E-11
sp|A4VTF3|FMT_STRSY Methionyl-tRNA formyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=fmt PE=3 SV=1 45 229 5.0E-11
sp|A4VZN1|FMT_STRS2 Methionyl-tRNA formyltransferase OS=Streptococcus suis (strain 98HAH33) GN=fmt PE=3 SV=1 45 229 5.0E-11
sp|A1WD32|FMT_ACISJ Methionyl-tRNA formyltransferase OS=Acidovorax sp. (strain JS42) GN=fmt PE=3 SV=1 125 265 5.0E-11
sp|Q1DCG7|FMT_MYXXD Methionyl-tRNA formyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=fmt PE=3 SV=1 45 293 6.0E-11
sp|C3KE47|FMT_PSEFS Methionyl-tRNA formyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=fmt PE=3 SV=1 41 267 6.0E-11
sp|Q4QMV7|FMT_HAEI8 Methionyl-tRNA formyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=fmt PE=3 SV=1 44 194 7.0E-11
sp|Q1JFP0|FMT_STRPD Methionyl-tRNA formyltransferase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=fmt PE=3 SV=1 44 229 7.0E-11
sp|B6JMY1|FMT_HELP2 Methionyl-tRNA formyltransferase OS=Helicobacter pylori (strain P12) GN=fmt PE=3 SV=1 44 295 8.0E-11
sp|B0U0T8|FMT_FRAP2 Methionyl-tRNA formyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=fmt PE=3 SV=1 125 267 8.0E-11
sp|Q73M65|FMT_TREDE Methionyl-tRNA formyltransferase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=fmt PE=3 SV=1 44 329 8.0E-11
sp|Q5FJH5|FMT_LACAC Methionyl-tRNA formyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=fmt PE=3 SV=1 46 229 8.0E-11
sp|A5VWJ8|FMT_PSEP1 Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fmt PE=3 SV=1 44 267 9.0E-11
sp|A0Q626|FMT_FRATN Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=fmt PE=3 SV=1 44 267 9.0E-11
sp|Q3SMS3|FMT_THIDA Methionyl-tRNA formyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=fmt PE=3 SV=1 44 265 1.0E-10
sp|B1XSN1|FMT_POLNS Methionyl-tRNA formyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=fmt PE=3 SV=1 44 282 1.0E-10
sp|Q9ZK72|FMT_HELPJ Methionyl-tRNA formyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=fmt PE=3 SV=1 44 295 1.0E-10
sp|Q88RR2|FMT_PSEPK Methionyl-tRNA formyltransferase OS=Pseudomonas putida (strain KT2440) GN=fmt PE=3 SV=1 44 265 1.0E-10
sp|Q2YC20|FMT_NITMU Methionyl-tRNA formyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=fmt PE=3 SV=1 125 355 1.0E-10
sp|A1KRE6|FMT_NEIMF Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=fmt PE=3 SV=1 125 286 1.0E-10
sp|Q8XJL3|FMT_CLOPE Methionyl-tRNA formyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=fmt PE=3 SV=1 44 266 2.0E-10
sp|Q1CSC6|FMT_HELPH Methionyl-tRNA formyltransferase OS=Helicobacter pylori (strain HPAG1) GN=fmt PE=3 SV=1 44 295 2.0E-10
sp|Q0SS78|FMT_CLOPS Methionyl-tRNA formyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=fmt PE=3 SV=1 44 266 2.0E-10
sp|A6TRW7|FMT_ALKMQ Methionyl-tRNA formyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=fmt PE=3 SV=1 44 265 2.0E-10
sp|P64138|FMT_STRA5 Methionyl-tRNA formyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=fmt PE=3 SV=1 45 267 2.0E-10
sp|P64137|FMT_STRA3 Methionyl-tRNA formyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=fmt PE=3 SV=1 45 267 2.0E-10
sp|Q3K365|FMT_STRA1 Methionyl-tRNA formyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=fmt PE=3 SV=1 45 267 2.0E-10
sp|Q2JTY2|FMT_SYNJA Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=fmt PE=3 SV=1 44 267 2.0E-10
sp|Q5F5P7|FMT_NEIG1 Methionyl-tRNA formyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fmt PE=3 SV=1 125 286 2.0E-10
sp|B2U795|FMT_RALPJ Methionyl-tRNA formyltransferase OS=Ralstonia pickettii (strain 12J) GN=fmt PE=3 SV=1 44 267 2.0E-10
sp|B2V4B2|FMT_CLOBA Methionyl-tRNA formyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=fmt PE=3 SV=1 44 267 3.0E-10
sp|A5FNN7|FMT_FLAJ1 Methionyl-tRNA formyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=fmt PE=3 SV=1 42 267 3.0E-10
sp|Q8DVK4|FMT_STRMU Methionyl-tRNA formyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fmt PE=3 SV=2 45 267 3.0E-10
sp|P59557|FMT_BUCBP Methionyl-tRNA formyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fmt PE=3 SV=1 42 194 3.0E-10
sp|Q2T2B1|FMT_BURTA Methionyl-tRNA formyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=fmt PE=3 SV=1 121 271 4.0E-10
sp|B4RPX5|FMT_NEIG2 Methionyl-tRNA formyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=fmt PE=3 SV=1 125 286 4.0E-10
sp|P56461|FMT_HELPY Methionyl-tRNA formyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=fmt PE=3 SV=1 44 295 4.0E-10
sp|A0LUE0|FMT_ACIC1 Methionyl-tRNA formyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=fmt PE=3 SV=1 44 267 4.0E-10
sp|A9BS67|FMT_DELAS Methionyl-tRNA formyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=fmt PE=3 SV=1 125 265 4.0E-10
sp|A9M463|FMT_NEIM0 Methionyl-tRNA formyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=fmt PE=3 SV=1 125 286 4.0E-10
sp|Q7VBU5|FMT_PROMA Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=fmt PE=3 SV=1 44 265 4.0E-10
sp|B2JJU4|FMT_BURP8 Methionyl-tRNA formyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=fmt PE=3 SV=1 41 265 4.0E-10
sp|Q6F155|FMT_MESFL Methionyl-tRNA formyltransferase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=fmt PE=3 SV=1 42 265 5.0E-10
sp|B5RKW3|FMT_BORDL Methionyl-tRNA formyltransferase OS=Borrelia duttonii (strain Ly) GN=fmt PE=3 SV=1 44 233 5.0E-10
sp|A1VU45|FMT_POLNA Methionyl-tRNA formyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=fmt PE=3 SV=1 125 282 5.0E-10
sp|B8G4D0|FMT_CHLAD Methionyl-tRNA formyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=fmt PE=3 SV=1 44 229 5.0E-10
sp|Q55163|FMT_SYNY3 Methionyl-tRNA formyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fmt PE=3 SV=1 44 265 6.0E-10
sp|Q8DNR7|FMT_STRR6 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fmt PE=3 SV=1 45 267 6.0E-10
sp|B2IS85|FMT_STRPS Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=fmt PE=3 SV=1 45 267 6.0E-10
sp|Q04J40|FMT_STRP2 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fmt PE=3 SV=1 45 267 6.0E-10
sp|A4IXN6|FMT_FRATW Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|Q5NGC1|FMT_FRATT Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|Q14HS3|FMT_FRAT1 Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|Q8YRI6|FMT_NOSS1 Methionyl-tRNA formyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|Q7TUA3|FMT_PROMP Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=fmt PE=3 SV=1 44 265 6.0E-10
sp|B9KBC2|FMT_THENN Methionyl-tRNA formyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fmt PE=3 SV=1 44 196 6.0E-10
sp|B0S140|FMT_FINM2 Methionyl-tRNA formyltransferase OS=Finegoldia magna (strain ATCC 29328) GN=fmt PE=3 SV=1 45 195 6.0E-10
sp|Q0BLC5|FMT_FRATO Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|Q2A2U6|FMT_FRATH Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|A7NCY0|FMT_FRATF Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=fmt PE=3 SV=1 44 267 6.0E-10
sp|Q3B2V0|FMT_CHLL7 Methionyl-tRNA formyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=fmt PE=3 SV=1 44 267 7.0E-10
sp|A2BRA1|FMT_PROMS Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=fmt PE=3 SV=1 44 266 7.0E-10
sp|B6YQF1|FMT_AZOPC Methionyl-tRNA formyltransferase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=fmt PE=3 SV=1 45 267 8.0E-10
sp|B5ZBV9|FMT_UREU1 Methionyl-tRNA formyltransferase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=fmt PE=3 SV=1 125 324 8.0E-10
sp|B2THS2|FMT_CLOBB Methionyl-tRNA formyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=fmt PE=3 SV=1 44 265 8.0E-10
sp|Q98RG4|FMT_MYCPU Methionyl-tRNA formyltransferase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=fmt PE=3 SV=1 44 282 8.0E-10
sp|B2SGG5|FMT_FRATM Methionyl-tRNA formyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=fmt PE=3 SV=1 44 267 8.0E-10
sp|A8F525|FMT_PSELT Methionyl-tRNA formyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=fmt PE=3 SV=1 44 267 9.0E-10
sp|Q147A4|FMT_BURXL Methionyl-tRNA formyltransferase OS=Burkholderia xenovorans (strain LB400) GN=fmt PE=3 SV=1 121 265 9.0E-10
sp|Q21RP5|FMT_RHOFT Methionyl-tRNA formyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=fmt PE=3 SV=1 44 282 9.0E-10
sp|A6LCS5|FMT_PARD8 Methionyl-tRNA formyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=fmt PE=3 SV=1 40 274 9.0E-10
sp|A1ALC4|FMT_PELPD Methionyl-tRNA formyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=fmt PE=3 SV=1 46 267 9.0E-10
sp|Q64PD6|FMT_BACFR Methionyl-tRNA formyltransferase OS=Bacteroides fragilis (strain YCH46) GN=fmt PE=3 SV=1 40 274 1.0E-09
sp|Q5L975|FMT_BACFN Methionyl-tRNA formyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=fmt PE=3 SV=1 40 274 1.0E-09
sp|A9AC69|FMT_BURM1 Methionyl-tRNA formyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=fmt PE=3 SV=1 44 267 1.0E-09
sp|Q0A5C0|FMT_ALKEH Methionyl-tRNA formyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=fmt PE=3 SV=1 45 277 1.0E-09
sp|Q3AXQ4|FMT_SYNS9 Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain CC9902) GN=fmt PE=3 SV=1 44 266 1.0E-09
sp|A1WQ79|FMT_VEREI Methionyl-tRNA formyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=fmt PE=3 SV=1 125 266 1.0E-09
sp|A1R5R2|FMT_ARTAT Methionyl-tRNA formyltransferase OS=Arthrobacter aurescens (strain TC1) GN=fmt PE=3 SV=1 44 265 1.0E-09
sp|C1CM71|FMT_STRZP Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=fmt PE=3 SV=1 45 229 1.0E-09
sp|C1CFV7|FMT_STRZJ Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=fmt PE=3 SV=1 45 229 1.0E-09
sp|B8ZMJ8|FMT_STRPJ Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fmt PE=3 SV=1 45 229 1.0E-09
sp|B5E782|FMT_STRP4 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=fmt PE=3 SV=1 45 229 1.0E-09
sp|Q3AC19|FMT_CARHZ Methionyl-tRNA formyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=fmt PE=3 SV=1 44 266 1.0E-09
sp|C0MH30|FMT_STRS7 Methionyl-tRNA formyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=fmt PE=3 SV=1 45 200 1.0E-09
sp|Q8D259|FMT_WIGBR Methionyl-tRNA formyltransferase OS=Wigglesworthia glossinidia brevipalpis GN=fmt PE=3 SV=1 41 287 1.0E-09
sp|Q182S2|FMT_PEPD6 Methionyl-tRNA formyltransferase OS=Peptoclostridium difficile (strain 630) GN=fmt PE=3 SV=1 44 197 1.0E-09
sp|B3WEW9|FMT_LACCB Methionyl-tRNA formyltransferase OS=Lactobacillus casei (strain BL23) GN=fmt PE=3 SV=1 46 200 1.0E-09
sp|B5RQP3|FMT_BORRA Methionyl-tRNA formyltransferase OS=Borrelia recurrentis (strain A1) GN=fmt PE=3 SV=1 44 233 1.0E-09
sp|C1CSZ4|FMT_STRZT Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=fmt PE=3 SV=1 45 229 2.0E-09
sp|Q97PA6|FMT_STRPN Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fmt PE=3 SV=1 45 229 2.0E-09
sp|B1I7J8|FMT_STRPI Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=fmt PE=3 SV=1 45 229 2.0E-09
sp|C1C8X2|FMT_STRP7 Methionyl-tRNA formyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=fmt PE=3 SV=1 45 229 2.0E-09
sp|A1TW87|FMT_ACIAC Methionyl-tRNA formyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=fmt PE=3 SV=1 127 282 2.0E-09
sp|B2S1P9|FMT_BORHD Methionyl-tRNA formyltransferase OS=Borrelia hermsii (strain HS1 / DAH) GN=fmt PE=3 SV=1 44 229 2.0E-09
sp|A9BAJ3|FMT_PROM4 Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain MIT 9211) GN=fmt PE=3 SV=1 44 267 2.0E-09
sp|Q63YR6|FMT_BURPS Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=fmt PE=3 SV=1 44 267 2.0E-09
sp|Q2JK54|FMT_SYNJB Methionyl-tRNA formyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=fmt PE=3 SV=1 44 267 2.0E-09
sp|A5FPB5|FMT_DEHMB Methionyl-tRNA formyltransferase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=fmt PE=3 SV=1 44 265 2.0E-09
sp|A6KWC4|FMT_BACV8 Methionyl-tRNA formyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=fmt PE=3 SV=1 44 274 2.0E-09
sp|Q31AS6|FMT_PROM9 Methionyl-tRNA formyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=fmt PE=3 SV=1 44 266 2.0E-09
sp|Q8Y3A8|FMT_RALSO Methionyl-tRNA formyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=fmt PE=3 SV=1 125 267 2.0E-09
sp|Q5ZSC5|FMT_LEGPH Methionyl-tRNA formyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=fmt PE=3 SV=1 44 335 2.0E-09
sp|A3NQ23|FMT_BURP0 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=fmt PE=3 SV=1 44 267 2.0E-09
sp|A3N4D4|FMT_BURP6 Methionyl-tRNA formyltransferase OS=Burkholderia pseudomallei (strain 668) GN=fmt PE=3 SV=1 44 267 2.0E-09
sp|Q5X1U6|FMT_LEGPA Methionyl-tRNA formyltransferase OS=Legionella pneumophila (strain Paris) GN=fmt PE=3 SV=1 44 295 2.0E-09
sp|A6WCA9|FMT_KINRD Methionyl-tRNA formyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=fmt PE=3 SV=1 44 279 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016742 hydroxymethyl-, formyl- and related transferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1634
MALSFVRHGGLCHQPPLATTGRCLLASPCRRFSTPVSRKQSDPLRILFCGSDAFSCASLAALYDEKKVNPGLIEA
IDVFMVPPKRYGRCFKQRRDVPCDILARSLDLPTHHRETFDDWELPHGVNLIIAVSFGLFVPGRLIRAAKYGGLN
IHPSFLPDLRGPAPLHRAMLRGDRHFGISLQTLDERHFDHGVVLAQTLRPGKPIAHDAHLKDVWSQASQAGAQML
IQGLRHRLHVPPYTNLVPQEEEKDLMHAHKVVKADSYINWAKWKTMADFDLRFRVLNWVWFWAYNRLGTLSRVII
HEMGPCSMESIQSKIWKKGTLSVTDQIGGERLELPVVAFDNQRLALRIGDEHQGEWVELHKVKSENEKCREDVAR
ALYRYIQYGGTGDTQKSGSQDEAQQLAE*
Coding >OphauG2|1634
ATGGCATTAAGCTTCGTCAGGCATGGTGGGCTCTGTCATCAGCCACCGCTCGCGACGACAGGCCGCTGTCTGCTG
GCCTCGCCTTGCCGCCGCTTCTCTACGCCCGTCTCGCGCAAACAGTCTGATCCATTGCGGATCCTCTTTTGTGGG
TCAGACGCTTTCAGCTGTGCCTCCTTGGCCGCTCTGTACGATGAAAAAAAGGTCAATCCGGGCCTCATTGAGGCC
ATTGACGTCTTCATGGTGCCGCCCAAGCGATACGGACGGTGTTTCAAGCAGCGCCGTGACGTTCCGTGTGATATC
TTGGCTAGATCTTTGGACTTGCCAACTCACCACCGGGAAACGTTCGACGATTGGGAGCTTCCACATGGAGTCAAC
TTGATAATCGCCGTCTCATTCGGTCTCTTTGTCCCCGGACGCTTGATCAGAGCGGCTAAATACGGCGGCCTAAAC
ATTCATCCTTCCTTTCTTCCCGATCTGCGTGGCCCGGCACCCCTCCATCGGGCTATGCTACGCGGTGACAGGCAC
TTTGGAATATCACTCCAAACTCTGGACGAGAGGCACTTTGACCACGGTGTCGTTCTAGCTCAGACTTTGCGTCCG
GGAAAGCCAATAGCTCATGATGCTCATTTGAAGGACGTTTGGTCGCAAGCATCCCAGGCTGGAGCGCAAATGCTC
ATTCAAGGGCTGCGCCACCGTCTGCACGTTCCCCCGTACACCAACCTTGTTCCCCAAGAAGAGGAAAAGGATCTT
ATGCATGCCCACAAGGTTGTTAAGGCTGACAGCTACATCAACTGGGCAAAGTGGAAAACCATGGCCGATTTCGAT
CTTCGATTCCGAGTTCTCAATTGGGTATGGTTCTGGGCTTACAATCGCCTGGGCACGCTATCACGAGTCATTATT
CACGAGATGGGACCTTGCTCGATGGAGTCGATCCAATCCAAAATATGGAAAAAGGGTACATTGTCCGTAACCGAT
CAGATAGGTGGAGAACGACTTGAGCTTCCAGTCGTGGCTTTTGACAATCAGCGCCTGGCTCTGCGCATTGGCGAT
GAGCATCAAGGAGAGTGGGTGGAACTGCACAAGGTCAAGTCTGAAAATGAAAAATGTCGAGAAGACGTTGCCAGA
GCGCTATATCGCTACATCCAATATGGAGGAACAGGGGACACGCAAAAAAGCGGAAGCCAAGATGAAGCACAACAG
TTGGCAGAATGA
Transcript >OphauG2|1634
ATGGCATTAAGCTTCGTCAGGCATGGTGGGCTCTGTCATCAGCCACCGCTCGCGACGACAGGCCGCTGTCTGCTG
GCCTCGCCTTGCCGCCGCTTCTCTACGCCCGTCTCGCGCAAACAGTCTGATCCATTGCGGATCCTCTTTTGTGGG
TCAGACGCTTTCAGCTGTGCCTCCTTGGCCGCTCTGTACGATGAAAAAAAGGTCAATCCGGGCCTCATTGAGGCC
ATTGACGTCTTCATGGTGCCGCCCAAGCGATACGGACGGTGTTTCAAGCAGCGCCGTGACGTTCCGTGTGATATC
TTGGCTAGATCTTTGGACTTGCCAACTCACCACCGGGAAACGTTCGACGATTGGGAGCTTCCACATGGAGTCAAC
TTGATAATCGCCGTCTCATTCGGTCTCTTTGTCCCCGGACGCTTGATCAGAGCGGCTAAATACGGCGGCCTAAAC
ATTCATCCTTCCTTTCTTCCCGATCTGCGTGGCCCGGCACCCCTCCATCGGGCTATGCTACGCGGTGACAGGCAC
TTTGGAATATCACTCCAAACTCTGGACGAGAGGCACTTTGACCACGGTGTCGTTCTAGCTCAGACTTTGCGTCCG
GGAAAGCCAATAGCTCATGATGCTCATTTGAAGGACGTTTGGTCGCAAGCATCCCAGGCTGGAGCGCAAATGCTC
ATTCAAGGGCTGCGCCACCGTCTGCACGTTCCCCCGTACACCAACCTTGTTCCCCAAGAAGAGGAAAAGGATCTT
ATGCATGCCCACAAGGTTGTTAAGGCTGACAGCTACATCAACTGGGCAAAGTGGAAAACCATGGCCGATTTCGAT
CTTCGATTCCGAGTTCTCAATTGGGTATGGTTCTGGGCTTACAATCGCCTGGGCACGCTATCACGAGTCATTATT
CACGAGATGGGACCTTGCTCGATGGAGTCGATCCAATCCAAAATATGGAAAAAGGGTACATTGTCCGTAACCGAT
CAGATAGGTGGAGAACGACTTGAGCTTCCAGTCGTGGCTTTTGACAATCAGCGCCTGGCTCTGCGCATTGGCGAT
GAGCATCAAGGAGAGTGGGTGGAACTGCACAAGGTCAAGTCTGAAAATGAAAAATGTCGAGAAGACGTTGCCAGA
GCGCTATATCGCTACATCCAATATGGAGGAACAGGGGACACGCAAAAAAGCGGAAGCCAAGATGAAGCACAACAG
TTGGCAGAATGA
Gene >OphauG2|1634
ATGGCATTAAGCTTCGTCAGGCATGGTGGGCTCTGTCATCAGCCACCGCTCGCGACGACAGGCCGCTGTCTGCTG
GCCTCGCCTTGCCGCCGCTTCTCTACGCCCGTCTCGCGCAAACAGTCTGATCCATTGCGGATCCTCTTTTGTGGG
TCAGACGCTTTCAGCTGTGCCTCCTTGGCCGCTCTGTACGATGAAAAAAAGGTCAATCCGGGCCTCATTGAGGCC
ATTGACGTCTTCATGGTGCCGCCCAAGCGATACGGACGGTGTTTCAAGCAGCGCCGTGACGGTATATTGAGGCCC
AAATCCGCAATCATATCCCCGTCATTGACTCTCAAAACCTTAGTTCCGTGTGATATCTTGGCTAGATCTTTGGAC
TTGCCAACTCACCACCGGGAAACGTTCGACGATTGGGAGGTATGTGCCTTGTGCTTCTTGATTGGCAGCTGGCTA
AAACCAAAATGCTTTAAGCTTCCACATGGAGTCAACTTGATAATCGCCGTCTCATTCGGTCTCTTTGTCCCCGGA
CGCTTGATCAGAGCGGCTAAATACGGCGGCCTAAACATTCATCCTTCCTTTCTTCCCGAGTAAGTTGAGCTGAGA
AGACAAGATGCAACCAACTTTATTGACACATGTTTATGGCAGTCTGCGTGGCCCGGCACCCCTCCATCGGGCTAT
GCTACGCGGTGACAGGCACTTTGGAATATCACTCCAAACTCTGGACGAGAGGCACTTTGACCACGGTGTCGTTCT
AGCTCAGACTTTGCGTCCGGGAAAGCCAATAGCTCATGATGCTCATTTGAAGGACGTTTGGTCGCAAGCATCCCA
GGCTGGAGCGCAAATGCTCATTCAAGGGCTGCGCCACCGTCTGCACGTTCCCCCGTACACCAACCTTGTTCCCCA
AGAAGAGGAAAAGGATCTTATGCATGCCCACAAGGTTGTTAAGGCTGACAGCTACATCAACTGGGCAAAGTGGAA
AACCATGGCCGATTTCGATCTTCGATTCCGAGTTCTCAATTGGGTATGGTTCTGGGCTTACAATCGCCTGGGCAC
GCTATCACGAGTCATTATTCACGAGATGGGACCTTGCTCGATGGAGTCGATCCAATCCAAAATATGGAAAAAGGG
TACATTGTCCGTAACCGATCAGATAGGTGGAGAACGACTTGAGCTTCCAGTCGTGGCTTTTGACAATCAGCGCCT
GGCTCTGCGCATTGGCGATGAGCATCAAGGAGAGTGGGTGGAACTGCACAAGGTCAAGTCTGAAAATGAAAAATG
TCGAGAAGACGTTGCCAGAGCGCTATATCGCTACATCCAATATGGAGGAACAGGGGACACGCAAAAAAGCGGAAG
CCAAGATGAAGCACAACAGTTGGCAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail