Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1630
Gene name
LocationContig_150:12428..13778
Strand-
Gene length (bp)1350
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00134 Cyclin_N Cyclin, N-terminal domain 1.2E-40 140 265
PF02984 Cyclin_C Cyclin, C-terminal domain 5.4E-27 268 380

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A0A9|CG24_CANAL G2/mitotic-specific cyclin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB4 PE=1 SV=1 108 382 1.0E-93
sp|P24870|CG23_YEAST G2/mitotic-specific cyclin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB3 PE=1 SV=3 135 395 1.0E-80
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 62 382 4.0E-80
sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig1 PE=1 SV=2 53 378 2.0E-79
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 126 383 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A0A9|CG24_CANAL G2/mitotic-specific cyclin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB4 PE=1 SV=1 108 382 1.0E-93
sp|P24870|CG23_YEAST G2/mitotic-specific cyclin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB3 PE=1 SV=3 135 395 1.0E-80
sp|P10815|CG23_SCHPO G2/mitotic-specific cyclin cdc13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc13 PE=1 SV=1 62 382 4.0E-80
sp|P24865|CG21_SCHPO G2/mitotic-specific cyclin cig1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig1 PE=1 SV=2 53 378 2.0E-79
sp|P30284|CG21_EMENI G2/mitotic-specific cyclin-B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimE PE=2 SV=1 126 383 2.0E-78
sp|P24871|CG24_YEAST G2/mitotic-specific cyclin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB4 PE=1 SV=2 124 387 3.0E-76
sp|P24869|CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB2 PE=1 SV=1 97 380 4.0E-67
sp|P36630|CG22_SCHPO G2/mitotic-specific cyclin cig2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cig2 PE=1 SV=2 129 389 6.0E-64
sp|Q5ALY0|CG21_CANAL G2/mitotic-specific cyclin CLB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLB2 PE=1 SV=1 121 378 4.0E-62
sp|P47829|CG21_CANAX G2/mitotic-specific cyclin CYB1 OS=Candida albicans GN=CYB1 PE=2 SV=1 121 378 7.0E-61
sp|P24868|CG21_YEAST G2/mitotic-specific cyclin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB1 PE=1 SV=1 131 380 9.0E-60
sp|O95067|CCNB2_HUMAN G2/mitotic-specific cyclin-B2 OS=Homo sapiens GN=CCNB2 PE=1 SV=1 126 382 3.0E-59
sp|Q4R7A8|CCNB2_MACFA G2/mitotic-specific cyclin-B2 OS=Macaca fascicularis GN=CCNB2 PE=2 SV=1 126 349 1.0E-58
sp|P13351|CCNB2_XENLA G2/mitotic-specific cyclin-B2 OS=Xenopus laevis GN=ccnb2 PE=1 SV=1 126 382 1.0E-58
sp|P51987|CCNB_HYDVD G2/mitotic-specific cyclin-B OS=Hydra viridissima PE=2 SV=1 104 382 2.0E-58
sp|P30276|CCNB2_MOUSE G2/mitotic-specific cyclin-B2 OS=Mus musculus GN=Ccnb2 PE=1 SV=2 126 349 2.0E-58
sp|O77689|CCNB2_BOVIN G2/mitotic-specific cyclin-B2 OS=Bos taurus GN=CCNB2 PE=2 SV=2 126 382 5.0E-58
sp|P37883|CCNB2_MESAU G2/mitotic-specific cyclin-B2 OS=Mesocricetus auratus GN=CCNB2 PE=2 SV=1 126 382 1.0E-57
sp|Q60FX9|CCNB2_ANGJA G2/mitotic-specific cyclin-B2 OS=Anguilla japonica GN=ccnb2 PE=2 SV=1 127 382 3.0E-55
sp|Q9IBG0|CCNB2_ORYLA G2/mitotic-specific cyclin-B2 OS=Oryzias latipes GN=ccnb2 PE=2 SV=1 119 382 3.0E-55
sp|P24860|CCNB1_MOUSE G2/mitotic-specific cyclin-B1 OS=Mus musculus GN=Ccnb1 PE=1 SV=3 92 382 3.0E-55
sp|O93229|CCNB2_RANJA G2/mitotic-specific cyclin-B2 OS=Rana japonica GN=CCNB2 PE=2 SV=1 126 378 3.0E-55
sp|Q08301|CCNB1_CRIGR G2/mitotic-specific cyclin-B1 OS=Cricetulus griseus GN=CCNB1 PE=2 SV=1 92 382 3.0E-55
sp|P37882|CCNB1_MESAU G2/mitotic-specific cyclin-B1 OS=Mesocricetus auratus GN=CCNB1 PE=2 SV=1 92 382 8.0E-55
sp|O14332|REM1_SCHPO Meiosis-specific cyclin rem1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rem1 PE=3 SV=1 129 378 1.0E-54
sp|Q9DG96|CCNB2_ORYLU G2/mitotic-specific cyclin-B2 OS=Oryzias luzonensis GN=ccnb2 PE=2 SV=1 119 382 1.0E-54
sp|P30277|CCNB1_RAT G2/mitotic-specific cyclin-B1 OS=Rattus norvegicus GN=Ccnb1 PE=2 SV=1 93 382 2.0E-54
sp|P14635|CCNB1_HUMAN G2/mitotic-specific cyclin-B1 OS=Homo sapiens GN=CCNB1 PE=1 SV=1 83 390 3.0E-54
sp|P32943|CGS6_YEAST S-phase entry cyclin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB6 PE=2 SV=2 127 353 4.0E-54
sp|P24862|CCNB_PATVU G2/mitotic-specific cyclin-B OS=Patella vulgata PE=2 SV=1 126 380 6.0E-54
sp|Q9DGA3|CCNB2_ORYCU G2/mitotic-specific cyclin-B2 OS=Oryzias curvinotus GN=ccnb2 PE=2 SV=1 119 382 8.0E-54
sp|P29332|CCNB2_CHICK G2/mitotic-specific cyclin-B2 OS=Gallus gallus GN=CCNB2 PE=2 SV=1 126 382 2.0E-53
sp|Q9DG99|CCNB2_ORYJA G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus GN=ccnb2 PE=2 SV=1 119 382 2.0E-53
sp|Q1LZG6|CCNB1_BOVIN G2/mitotic-specific cyclin-B1 OS=Bos taurus GN=CCNB1 PE=2 SV=1 80 390 2.0E-53
sp|P51988|CCNB_HYDVU G2/mitotic-specific cyclin-B (Fragment) OS=Hydra vulgaris PE=2 SV=1 125 382 2.0E-53
sp|P15206|CCNB_MARGL G2/mitotic-specific cyclin-B OS=Marthasterias glacialis PE=2 SV=1 97 391 6.0E-53
sp|P13952|CCNB_SPISO G2/mitotic-specific cyclin-B OS=Spisula solidissima PE=2 SV=1 126 378 2.0E-52
sp|P07818|CCNB_ARBPU G2/mitotic-specific cyclin-B OS=Arbacia punctulata PE=2 SV=1 126 382 5.0E-52
sp|P13350|CCNB1_XENLA G2/mitotic-specific cyclin-B1 OS=Xenopus laevis GN=ccnb1 PE=1 SV=1 83 382 4.0E-50
sp|Q9DGA4|CCNB1_ORYCU G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotus GN=ccnb1 PE=2 SV=1 89 348 5.0E-50
sp|P30283|CGS5_YEAST S-phase entry cyclin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLB5 PE=1 SV=1 115 376 1.0E-49
sp|Q92162|CCNB1_CARAU G2/mitotic-specific cyclin-B1 OS=Carassius auratus GN=ccnb1 PE=2 SV=1 89 373 6.0E-49
sp|Q60FY0|CCNB1_ANGJA G2/mitotic-specific cyclin-B1 OS=Anguilla japonica GN=ccnb1 PE=2 SV=1 126 373 6.0E-48
sp|Q9DGA0|CCNB1_ORYJA G2/mitotic-specific cyclin-B1 OS=Oryzias javanicus GN=ccnb1 PE=2 SV=2 89 390 7.0E-48
sp|Q9IBG1|CCNB1_ORYLA G2/mitotic-specific cyclin-B1 OS=Oryzias latipes GN=ccnb1 PE=2 SV=1 89 348 6.0E-47
sp|P42524|CCNB_DICDI G2/mitotic-specific cyclin-B OS=Dictyostelium discoideum GN=cycB PE=1 SV=1 104 380 8.0E-47
sp|Q9DG97|CCNB1_ORYLU G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensis GN=ccnb1 PE=2 SV=1 89 348 8.0E-47
sp|Q6AY13|CCNA1_RAT Cyclin-A1 OS=Rattus norvegicus GN=Ccna1 PE=2 SV=1 122 380 6.0E-45
sp|Q61456|CCNA1_MOUSE Cyclin-A1 OS=Mus musculus GN=Ccna1 PE=1 SV=2 122 380 8.0E-45
sp|P78396|CCNA1_HUMAN Cyclin-A1 OS=Homo sapiens GN=CCNA1 PE=1 SV=1 122 380 4.0E-44
sp|Q9FMH5|CCA31_ARATH Putative cyclin-A3-1 OS=Arabidopsis thaliana GN=CYCA3-1 PE=3 SV=1 130 375 2.0E-42
sp|Q2QQ96|CCA21_ORYSJ Cyclin-A2-1 OS=Oryza sativa subsp. japonica GN=CYCA2-1 PE=2 SV=1 101 375 2.0E-42
sp|P18606|CCNA1_XENLA Cyclin-A1 OS=Xenopus laevis GN=ccna1 PE=2 SV=1 126 380 3.0E-41
sp|Q7F830|CCA11_ORYSJ Cyclin-A1-1 OS=Oryza sativa subsp. japonica GN=CYCA1-1 PE=2 SV=1 123 375 9.0E-41
sp|Q9LDM4|CCB23_ARATH Cyclin-B2-3 OS=Arabidopsis thaliana GN=CYCB2-3 PE=2 SV=2 127 391 9.0E-41
sp|Q7XSJ6|CCB21_ORYSJ Cyclin-B2-1 OS=Oryza sativa subsp. japonica GN=CYCB2-1 PE=1 SV=2 127 353 2.0E-40
sp|Q01J96|CCB21_ORYSI Cyclin-B2-1 OS=Oryza sativa subsp. indica GN=CYCB2-1 PE=1 SV=1 127 353 2.0E-40
sp|Q0INT0|CCA13_ORYSJ Cyclin-A1-3 OS=Oryza sativa subsp. japonica GN=CYCA1-3 PE=2 SV=2 123 375 2.0E-40
sp|Q0DJR9|CCA14_ORYSJ Cyclin-A1-4 OS=Oryza sativa subsp. japonica GN=CYCA1-4 PE=2 SV=2 123 375 2.0E-40
sp|Q0JPA4|CCA12_ORYSJ Cyclin-A1-2 OS=Oryza sativa subsp. japonica GN=CYCA1-2 PE=3 SV=2 123 351 4.0E-40
sp|Q0DH40|CCB15_ORYSJ Cyclin-B1-5 OS=Oryza sativa subsp. japonica GN=CYCB1-5 PE=3 SV=1 85 379 7.0E-40
sp|Q9FVX0|CCA12_ARATH Cyclin-A1-2 OS=Arabidopsis thaliana GN=CYCA1-2 PE=1 SV=2 127 375 1.0E-39
sp|Q9SFW6|CCB24_ARATH Cyclin-B2-4 OS=Arabidopsis thaliana GN=CYCB2-4 PE=2 SV=2 127 391 2.0E-39
sp|Q9C6A9|CCA32_ARATH Cyclin-A3-2 OS=Arabidopsis thaliana GN=CYCA3-2 PE=2 SV=1 106 378 2.0E-39
sp|P20439|CCNB_DROME G2/mitotic-specific cyclin-B OS=Drosophila melanogaster GN=CycB PE=1 SV=2 126 379 3.0E-39
sp|P46277|CCNB1_MEDSV G2/mitotic-specific cyclin-1 OS=Medicago sativa subsp. varia PE=2 SV=1 127 316 5.0E-39
sp|Q9C6Y3|CCA11_ARATH Cyclin-A1-1 OS=Arabidopsis thaliana GN=CYCA1-1 PE=1 SV=1 130 351 5.0E-39
sp|P18063|CCNB_PATPE G2/mitotic-specific cyclin-B OS=Patiria pectinifera PE=2 SV=2 126 351 2.0E-38
sp|P37881|CCNA2_MESAU Cyclin-A2 OS=Mesocricetus auratus GN=CCNA2 PE=2 SV=1 134 380 3.0E-38
sp|Q0D9C7|CCB22_ORYSJ Cyclin-B2-2 OS=Oryza sativa subsp. japonica GN=CYCB2-2 PE=1 SV=1 127 316 3.0E-38
sp|A2YH60|CCB22_ORYSI Cyclin-B2-2 OS=Oryza sativa subsp. indica GN=CYCB2-2 PE=1 SV=2 127 316 3.0E-38
sp|P47827|CCNA2_XENLA Cyclin-A2 OS=Xenopus laevis GN=ccna2 PE=2 SV=1 134 381 4.0E-38
sp|P51943|CCNA2_MOUSE Cyclin-A2 OS=Mus musculus GN=Ccna2 PE=1 SV=2 134 380 5.0E-38
sp|P51986|CCNA_HYDVD G2/mitotic-specific cyclin-A (Fragment) OS=Hydra viridissima PE=2 SV=1 122 381 5.0E-38
sp|P34800|CCN1_ANTMA G2/mitotic-specific cyclin-1 OS=Antirrhinum majus PE=2 SV=1 127 352 6.0E-38
sp|Q0JIF2|CCB11_ORYSJ Cyclin-B1-1 OS=Oryza sativa subsp. japonica GN=CYCB1-1 PE=2 SV=2 111 379 7.0E-38
sp|P30274|CCNA2_BOVIN Cyclin-A2 OS=Bos taurus GN=CCNA2 PE=1 SV=2 134 380 9.0E-38
sp|P30278|CCNB2_MEDSA G2/mitotic-specific cyclin-2 (Fragment) OS=Medicago sativa PE=2 SV=1 127 345 1.0E-37
sp|P20248|CCNA2_HUMAN Cyclin-A2 OS=Homo sapiens GN=CCNA2 PE=1 SV=2 134 380 2.0E-37
sp|P39963|CCNB3_CHICK G2/mitotic-specific cyclin-B3 OS=Gallus gallus GN=CCNB3 PE=2 SV=1 126 374 2.0E-37
sp|P43449|CCNA2_CHICK Cyclin-A2 OS=Gallus gallus GN=CCNA2 PE=2 SV=1 134 380 3.0E-37
sp|Q147G5|CCA22_ARATH Cyclin-A2-2 OS=Arabidopsis thaliana GN=CYCA2-2 PE=2 SV=1 123 326 4.0E-37
sp|P24861|CCNA_PATVU G2/mitotic-specific cyclin-A OS=Patella vulgata PE=2 SV=1 134 375 5.0E-37
sp|P46278|CCNB2_MEDSV G2/mitotic-specific cyclin-2 OS=Medicago sativa subsp. varia PE=2 SV=1 127 345 5.0E-37
sp|P25010|CCNAL_DAUCA G2/mitotic-specific cyclin C13-1 (Fragment) OS=Daucus carota PE=2 SV=1 123 378 1.0E-36
sp|A0MEB5|CCA33_ARATH Cyclin-A3-3 OS=Arabidopsis thaliana GN=CYCA3-3 PE=2 SV=2 97 380 2.0E-36
sp|Q659K0|CCNB3_CANLF G2/mitotic-specific cyclin-B3 OS=Canis lupus familiaris GN=CCNB3 PE=2 SV=1 122 374 4.0E-36
sp|Q39071|CCA21_ARATH Cyclin-A2-1 OS=Arabidopsis thaliana GN=CYCA2-1 PE=2 SV=3 123 375 6.0E-36
sp|Q9I7I0|CCNB3_DROME G2/mitotic-specific cyclin-B3 OS=Drosophila melanogaster GN=CycB3 PE=1 SV=1 130 380 7.0E-36
sp|Q38819|CCA23_ARATH Cyclin-A2-3 OS=Arabidopsis thaliana GN=CYCA2-3 PE=1 SV=2 114 381 1.0E-35
sp|P25011|CCNB1_SOYBN G2/mitotic-specific cyclin S13-6 OS=Glycine max PE=2 SV=1 127 345 1.0E-35
sp|P25012|CCNB2_SOYBN G2/mitotic-specific cyclin S13-7 (Fragment) OS=Glycine max PE=2 SV=1 140 352 2.0E-35
sp|Q9C968|CCA24_ARATH Cyclin-A2-4 OS=Arabidopsis thaliana GN=CYCA2-4 PE=2 SV=1 116 398 2.0E-35
sp|Q39067|CCB12_ARATH Cyclin-B1-2 OS=Arabidopsis thaliana GN=CYCB1-2 PE=1 SV=2 81 380 2.0E-34
sp|Q39068|CCB21_ARATH Cyclin-B2-1 OS=Arabidopsis thaliana GN=CYCB2-1 PE=1 SV=2 85 374 4.0E-34
sp|Q39069|CCB13_ARATH Cyclin-B1-3 OS=Arabidopsis thaliana GN=CYCB1-3 PE=2 SV=2 137 345 2.0E-33
sp|Q8WWL7|CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens GN=CCNB3 PE=1 SV=2 122 374 2.0E-33
sp|Q810T2|CCNB3_MOUSE G2/mitotic-specific cyclin-B3 OS=Mus musculus GN=Ccnb3 PE=1 SV=2 130 374 3.0E-33
sp|Q75I54|CCA31_ORYSJ Cyclin-A3-1 OS=Oryza sativa subsp. japonica GN=CYCA3-1 PE=3 SV=1 133 381 5.0E-33
sp|Q92161|CCNA1_CARAU Cyclin-A1 OS=Carassius auratus GN=ccna1 PE=2 SV=1 120 380 9.0E-33
sp|Q3ECW2|CCA34_ARATH Cyclin-A3-4 OS=Arabidopsis thaliana GN=CYCA3-4 PE=1 SV=1 130 324 1.0E-32
sp|P30183|CCB11_ARATH Cyclin-B1-1 OS=Arabidopsis thaliana GN=CYCB1-1 PE=1 SV=2 94 345 1.0E-32
sp|O48790|CCB14_ARATH Cyclin-B1-4 OS=Arabidopsis thaliana GN=CYCB1-4 PE=2 SV=1 127 370 2.0E-32
sp|P34801|CCN2_ANTMA G2/mitotic-specific cyclin-2 OS=Antirrhinum majus PE=2 SV=1 127 353 2.0E-32
sp|Q9SA32|CCB31_ARATH Putative cyclin-B3-1 OS=Arabidopsis thaliana GN=CYCB3-1 PE=3 SV=2 83 315 4.0E-32
sp|Q10654|CCNB3_CAEEL G2/mitotic-specific cyclin-B3 OS=Caenorhabditis elegans GN=cyb-3 PE=2 SV=3 125 374 4.0E-32
sp|Q39070|CCB22_ARATH Cyclin-B2-2 OS=Arabidopsis thaliana GN=CYCB2-2 PE=1 SV=2 127 374 1.0E-31
sp|P04962|CCNA_SPISO G2/mitotic-specific cyclin-A OS=Spisula solidissima PE=2 SV=1 134 378 1.0E-31
sp|Q2QN26|CCA32_ORYSJ Cyclin-A3-2 OS=Oryza sativa subsp. japonica GN=CYCA3-2 PE=2 SV=1 137 309 2.0E-31
sp|Q0JNK6|CCB13_ORYSJ Cyclin-B1-3 OS=Oryza sativa subsp. japonica GN=CYCB1-3 PE=2 SV=2 126 379 5.0E-31
sp|Q10653|CCNB1_CAEEL G2/mitotic-specific cyclin-B1 OS=Caenorhabditis elegans GN=cyb-1 PE=1 SV=1 136 321 1.0E-29
sp|P14785|CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster GN=CycA PE=1 SV=3 134 329 1.0E-28
sp|P34638|CCNA1_CAEEL G2/mitotic-specific cyclin-A1 OS=Caenorhabditis elegans GN=cya-1 PE=1 SV=2 140 371 3.0E-27
sp|Q10Q63|CCF31_ORYSJ Putative cyclin-F3-1 OS=Oryza sativa subsp. japonica GN=CYCF3-1 PE=3 SV=1 134 319 9.0E-26
sp|Q10Q62|CCF32_ORYSJ Putative cyclin-F3-2 OS=Oryza sativa subsp. japonica GN=CYCF3-2 PE=3 SV=1 134 399 2.0E-24
sp|Q59YH3|CG11_CANAL G1/S-specific cyclin CCN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCN1 PE=1 SV=1 125 325 3.0E-23
sp|P0CY18|CG11_CANAX G1/S-specific cyclin CLN1 OS=Candida albicans GN=CLN1 PE=3 SV=1 125 325 3.0E-23
sp|C4YR54|CG11_CANAW G1/S-specific cyclin CCN1 OS=Candida albicans (strain WO-1) GN=CCN1 PE=3 SV=1 125 325 3.0E-23
sp|Q9LM91|CCB25_ARATH Cyclin-B2-5 OS=Arabidopsis thaliana GN=CYCB2-5 PE=3 SV=2 198 389 3.0E-23
sp|Q32NM1|CCNOB_XENLA Cyclin-O protein B OS=Xenopus laevis GN=ccno-b PE=2 SV=1 137 313 3.0E-21
sp|Q32NJ2|CCNOA_XENLA Cyclin-O protein A OS=Xenopus laevis GN=ccno-a PE=2 SV=1 137 315 6.0E-20
sp|P22674|CCNO_HUMAN Cyclin-O OS=Homo sapiens GN=CCNO PE=1 SV=2 137 321 1.0E-19
sp|Q5E9K7|CCNE2_BOVIN G1/S-specific cyclin-E2 OS=Bos taurus GN=CCNE2 PE=2 SV=1 131 265 1.0E-18
sp|P0C242|CCNO_MOUSE Cyclin-O OS=Mus musculus GN=Ccno PE=1 SV=1 137 321 5.0E-18
sp|Q9Z238|CCNE2_MOUSE G1/S-specific cyclin-E2 OS=Mus musculus GN=Ccne2 PE=1 SV=1 131 318 6.0E-18
sp|O96020|CCNE2_HUMAN G1/S-specific cyclin-E2 OS=Homo sapiens GN=CCNE2 PE=1 SV=1 131 265 1.0E-17
sp|P25009|PUC1_SCHPO Cyclin puc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puc1 PE=3 SV=1 122 343 1.0E-16
sp|O15995|CCNE_HEMPU G1/S-specific cyclin-E OS=Hemicentrotus pulcherrimus GN=CYCE PE=2 SV=1 140 265 5.0E-16
sp|P54733|CCNE_DROME G1/S-specific cyclin-E OS=Drosophila melanogaster GN=CycE PE=1 SV=2 168 269 7.0E-15
sp|Q6K1Z6|CCF21_ORYSJ Putative cyclin-F2-1 OS=Oryza sativa subsp. japonica GN=CycF2-1 PE=3 SV=2 129 354 1.0E-14
sp|Q61457|CCNE1_MOUSE G1/S-specific cyclin-E1 OS=Mus musculus GN=Ccne1 PE=1 SV=2 131 266 5.0E-14
sp|Q9H8S5|CNTD2_HUMAN Cyclin N-terminal domain-containing protein 2 OS=Homo sapiens GN=CNTD2 PE=2 SV=2 137 301 9.0E-14
sp|P25322|CCND1_MOUSE G1/S-specific cyclin-D1 OS=Mus musculus GN=Ccnd1 PE=1 SV=1 141 337 1.0E-13
sp|P39949|CCNE1_RAT G1/S-specific cyclin-E1 OS=Rattus norvegicus GN=Ccne1 PE=2 SV=2 131 266 2.0E-13
sp|Q5SCB5|CCND_OSTTA Cyclin-D OS=Ostreococcus tauri GN=CycD PE=3 SV=1 169 390 2.0E-13
sp|Q90459|CCND1_DANRE G1/S-specific cyclin-D1 OS=Danio rerio GN=ccnd1 PE=2 SV=1 120 316 2.0E-13
sp|P39948|CCND1_RAT G1/S-specific cyclin-D1 OS=Rattus norvegicus GN=Ccnd1 PE=2 SV=1 141 337 4.0E-13
sp|P55169|CCND1_CHICK G1/S-specific cyclin-D1 OS=Gallus gallus GN=CCND1 PE=2 SV=1 141 316 5.0E-13
sp|P24864|CCNE1_HUMAN G1/S-specific cyclin-E1 OS=Homo sapiens GN=CCNE1 PE=1 SV=2 131 266 3.0E-12
sp|P30279|CCND2_HUMAN G1/S-specific cyclin-D2 OS=Homo sapiens GN=CCND2 PE=1 SV=1 148 316 4.0E-12
sp|Q2KI22|CCND1_BOVIN G1/S-specific cyclin-D1 OS=Bos taurus GN=CCND1 PE=2 SV=1 141 310 4.0E-12
sp|P30281|CCND3_HUMAN G1/S-specific cyclin-D3 OS=Homo sapiens GN=CCND3 PE=1 SV=2 130 316 4.0E-12
sp|Q3MHH5|CCND3_BOVIN G1/S-specific cyclin-D3 OS=Bos taurus GN=CCND3 PE=2 SV=1 130 316 5.0E-12
sp|P47794|CCNE1_DANRE G1/S-specific cyclin-E1 OS=Danio rerio GN=ccne1 PE=2 SV=1 156 274 6.0E-12
sp|Q8WNW2|CCND2_PIG G1/S-specific cyclin-D2 OS=Sus scrofa GN=CCND2 PE=2 SV=1 137 316 6.0E-12
sp|Q91780|CCNE2_XENLA G1/S-specific cyclin-E2 OS=Xenopus laevis GN=cyce2 PE=2 SV=1 157 266 7.0E-12
sp|P50756|CCNE1_XENLA G1/S-specific cyclin-E1 OS=Xenopus laevis GN=cyce1 PE=2 SV=1 157 266 7.0E-12
sp|Q64HP0|CCND1_CANLF G1/S-specific cyclin-D1 OS=Canis lupus familiaris GN=CCND1 PE=2 SV=1 141 310 8.0E-12
sp|Q1PFW3|CCSDS_ARATH Cyclin-SDS OS=Arabidopsis thaliana GN=SDS PE=1 SV=2 168 335 9.0E-12
sp|Q0P5D3|CCND2_BOVIN G1/S-specific cyclin-D2 OS=Bos taurus GN=CCND2 PE=2 SV=1 137 316 9.0E-12
sp|Q39072|CCB15_ARATH Cyclin-B1-5 OS=Arabidopsis thaliana GN=CYCB1-5 PE=2 SV=3 109 296 1.0E-11
sp|P30282|CCND3_MOUSE G1/S-specific cyclin-D3 OS=Mus musculus GN=Ccnd3 PE=1 SV=1 130 324 1.0E-11
sp|P49707|CCNE1_CHICK G1/S-specific cyclin-E1 OS=Gallus gallus GN=CCNE1 PE=2 SV=1 129 266 1.0E-11
sp|Q04827|CCND2_RAT G1/S-specific cyclin-D2 OS=Rattus norvegicus GN=Ccnd2 PE=1 SV=1 148 316 2.0E-11
sp|P30280|CCND2_MOUSE G1/S-specific cyclin-D2 OS=Mus musculus GN=Ccnd2 PE=1 SV=1 148 316 2.0E-11
sp|P48961|CCND3_RAT G1/S-specific cyclin-D3 OS=Rattus norvegicus GN=Ccnd3 PE=1 SV=1 130 324 2.0E-11
sp|Q8MUK3|CCNE_CAEBR G1/S-specific cyclin-E OS=Caenorhabditis briggsae GN=cye-1 PE=2 SV=1 169 278 3.0E-11
sp|O01501|CCNE_CAEEL G1/S-specific cyclin-E OS=Caenorhabditis elegans GN=cye-1 PE=2 SV=2 164 266 3.0E-11
sp|Q10PQ9|CCSDS_ORYSJ Cyclin-SDS-like OS=Oryza sativa subsp. japonica GN=SDS PE=2 SV=1 170 310 3.0E-11
sp|P50755|CCND1_XENLA G1/S-specific cyclin-D1 OS=Xenopus laevis GN=ccnd1 PE=1 SV=1 143 327 3.0E-11
sp|P24385|CCND1_HUMAN G1/S-specific cyclin-D1 OS=Homo sapiens GN=CCND1 PE=1 SV=1 141 310 6.0E-11
sp|Q5R6J5|CCND1_PONAB G1/S-specific cyclin-D1 OS=Pongo abelii GN=CCND1 PE=2 SV=1 141 310 7.0E-11
sp|P49706|CCND2_CHICK G1/S-specific cyclin-D2 OS=Gallus gallus GN=CCND2 PE=3 SV=1 128 316 9.0E-11
sp|O42575|CCNE3_XENLA G1/S-specific cyclin-E3 OS=Xenopus laevis GN=cyce3 PE=2 SV=1 157 266 1.0E-10
sp|Q6K8S0|CCF22_ORYSJ Cyclin-F2-2 OS=Oryza sativa subsp. japonica GN=CYCF2-2 PE=2 SV=1 129 353 2.0E-10
sp|P53782|CCND2_XENLA G1/S-specific cyclin-D2 OS=Xenopus laevis GN=ccnd2 PE=2 SV=1 148 316 3.0E-09
sp|Q3TZI6|CCNJ_MOUSE Cyclin-J OS=Mus musculus GN=Ccnj PE=2 SV=2 169 382 1.0E-08
sp|Q5XGG5|CCNF_XENTR Cyclin-F OS=Xenopus tropicalis GN=ccnf PE=2 SV=1 156 348 1.0E-08
sp|Q7T0L6|CCNF_XENLA Cyclin-F OS=Xenopus laevis GN=ccnf PE=2 SV=1 162 300 3.0E-08
sp|P43062|CG12_CANAX G1/S-specific cyclin CLN2 OS=Candida albicans GN=CLN2 PE=3 SV=1 134 268 5.0E-08
sp|Q5A1N6|CG13_CANAL G1/S-specific cyclin CLN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLN3 PE=1 SV=1 134 268 6.0E-08
sp|Q6YXH8|CCD41_ORYSJ Cyclin-D4-1 OS=Oryza sativa subsp. japonica GN=CYCD4-1 PE=2 SV=2 138 281 9.0E-08
sp|Q6DFJ9|CCNJ_XENLA Cyclin-J OS=Xenopus laevis GN=ccnj PE=2 SV=1 169 364 1.0E-07
sp|Q6NYX6|CCNF_DANRE Cyclin-F OS=Danio rerio GN=ccnf PE=2 SV=1 140 351 1.0E-07
sp|Q10QA2|CCD53_ORYSJ Cyclin-D5-3 OS=Oryza sativa subsp. japonica GN=CYCD5-3 PE=2 SV=1 170 320 2.0E-07
sp|Q8LHA8|CCD22_ORYSJ Cyclin-D2-2 OS=Oryza sativa subsp. japonica GN=CYCD2-2 PE=2 SV=1 138 310 2.0E-07
sp|Q0J233|CCD21_ORYSJ Cyclin-D2-1 OS=Oryza sativa subsp. japonica GN=CYCD2-1 PE=3 SV=2 149 316 3.0E-07
sp|P51944|CCNF_MOUSE Cyclin-F OS=Mus musculus GN=Ccnf PE=2 SV=2 169 351 5.0E-07
sp|P41002|CCNF_HUMAN Cyclin-F OS=Homo sapiens GN=CCNF PE=1 SV=2 162 300 1.0E-06
sp|Q9SN11|CCD33_ARATH Cyclin-D3-3 OS=Arabidopsis thaliana GN=CYCD3-3 PE=2 SV=1 170 315 1.0E-06
sp|Q0WQN9|CCD42_ARATH Cyclin-D4-2 OS=Arabidopsis thaliana GN=CYCD4-2 PE=1 SV=2 138 286 2.0E-06
sp|Q4KYM5|CCD42_ORYSJ Cyclin-D4-2 OS=Oryza sativa subsp. japonica GN=CYCD4-2 PE=2 SV=2 138 233 2.0E-06
sp|P42753|CCD31_ARATH Cyclin-D3-1 OS=Arabidopsis thaliana GN=CYCD3-1 PE=1 SV=3 170 316 2.0E-06
sp|Q8K4F8|CCNF_RAT Cyclin-F OS=Rattus norvegicus GN=Ccnf PE=2 SV=2 169 351 2.0E-06
sp|Q9FGQ7|CCD32_ARATH Cyclin-D3-2 OS=Arabidopsis thaliana GN=CYCD3-2 PE=2 SV=1 170 320 4.0E-06
sp|Q6K1Z1|CCF11_ORYSJ Putative cyclin-F1-1 OS=Oryza sativa subsp. japonica GN=CYCF1-1 PE=3 SV=1 92 322 4.0E-06
sp|Q8H339|CCD12_ORYSJ Cyclin-D1-2 OS=Oryza sativa subsp. japonica GN=CYCD1-2 PE=3 SV=2 155 316 4.0E-06
sp|P42751|CCD11_ARATH Cyclin-D1-1 OS=Arabidopsis thaliana GN=CYCD1-1 PE=1 SV=3 144 316 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3727
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1630 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5835
Ophiocordyceps camponoti-floridani Ophcf2|04849
Ophiocordyceps camponoti-rufipedis Ophun1|6102
Ophiocordyceps kimflemingae Ophio5|513
Ophiocordyceps subramaniannii Hirsu2|7277

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1630
MIANSHATAHDGHTALIPLPANQEHLANDCESCDLEVCQDCELNLEVDDSRPVQIYSQGNESRDEHVGYEGIELY
MTTYDGLPPKTVLDPTHPVIAPRRYSACDLEEINAAKLVIGGTVAYQDLLDDMSDPYMVAGYSQEIFTYMHELET
RMLPYTHYMDGQEEVDWRMRSILINWIVDVHDRFRLLPETLFLAVNYIDRFLCGKIVSTAKLQLVGVTALLVATK
YEEISCPEIREIGSVVENCYSDNDIIKAERYMLTMLGFELGWPGPLNFLRRISKADSYDVETRTMAKYFLELALV
DYRFVSTLPSYLAAATHCLAMLILEKGYWKFLHVYYSGFTYRQLLPAIQTLLNCLERPLWHHESVFTKYTEERFQ
STSLVVQRVLSSGFVLPNHRYVGGPVAYHE*
Coding >OphauG2|1630
ATGATAGCTAACAGTCATGCTACCGCGCATGATGGTCATACTGCTCTGATTCCCCTGCCTGCAAACCAAGAACAT
CTAGCAAACGATTGTGAAAGCTGCGACCTCGAAGTATGCCAAGACTGCGAGTTGAACTTGGAAGTTGATGACTCT
CGCCCCGTTCAAATCTACAGTCAAGGCAACGAGTCTCGAGATGAGCACGTCGGATACGAAGGCATAGAACTCTAC
ATGACCACTTATGATGGATTGCCTCCCAAGACGGTCCTTGACCCTACACACCCTGTGATCGCGCCTCGTCGCTAC
TCAGCCTGCGATCTTGAAGAGATCAACGCCGCAAAATTGGTGATTGGTGGAACCGTTGCGTACCAGGACCTCCTT
GACGACATGAGCGATCCATACATGGTGGCTGGATACAGCCAAGAGATATTTACGTACATGCACGAGCTCGAGACC
AGGATGCTCCCCTATACTCACTACATGGATGGACAAGAGGAGGTGGATTGGCGCATGCGGTCCATTCTTATTAAT
TGGATCGTCGACGTCCACGATCGCTTTCGCCTGCTTCCTGAGACTCTCTTCTTGGCAGTCAACTATATTGATCGC
TTCCTCTGTGGCAAGATTGTGTCGACGGCCAAATTGCAATTGGTGGGCGTTACGGCTCTTCTGGTAGCTACCAAG
TACGAGGAGATTAGTTGCCCCGAGATTCGCGAGATCGGTTCCGTTGTGGAGAATTGCTACTCGGATAATGATATC
ATCAAGGCCGAACGATACATGCTCACCATGCTCGGGTTTGAGCTGGGGTGGCCTGGGCCCTTGAACTTCTTGCGG
CGCATCAGCAAAGCCGATTCCTACGACGTGGAGACGAGAACAATGGCAAAATACTTTCTGGAATTGGCCCTCGTG
GATTATCGATTTGTTTCAACCCTGCCAAGCTATCTGGCGGCAGCGACCCACTGTTTGGCGATGCTGATTCTGGAG
AAGGGCTATTGGAAATTTCTACACGTTTACTATTCCGGTTTCACGTATCGCCAGCTACTGCCCGCTATCCAAACG
CTGTTGAACTGCTTGGAGAGACCACTTTGGCACCACGAGTCCGTCTTCACGAAGTATACCGAAGAGCGATTTCAA
TCGACATCTCTAGTGGTGCAAAGGGTGCTCTCAAGTGGCTTTGTGTTACCTAACCACCGCTACGTCGGAGGGCCG
GTGGCGTATCACGAGTAA
Transcript >OphauG2|1630
ATGATAGCTAACAGTCATGCTACCGCGCATGATGGTCATACTGCTCTGATTCCCCTGCCTGCAAACCAAGAACAT
CTAGCAAACGATTGTGAAAGCTGCGACCTCGAAGTATGCCAAGACTGCGAGTTGAACTTGGAAGTTGATGACTCT
CGCCCCGTTCAAATCTACAGTCAAGGCAACGAGTCTCGAGATGAGCACGTCGGATACGAAGGCATAGAACTCTAC
ATGACCACTTATGATGGATTGCCTCCCAAGACGGTCCTTGACCCTACACACCCTGTGATCGCGCCTCGTCGCTAC
TCAGCCTGCGATCTTGAAGAGATCAACGCCGCAAAATTGGTGATTGGTGGAACCGTTGCGTACCAGGACCTCCTT
GACGACATGAGCGATCCATACATGGTGGCTGGATACAGCCAAGAGATATTTACGTACATGCACGAGCTCGAGACC
AGGATGCTCCCCTATACTCACTACATGGATGGACAAGAGGAGGTGGATTGGCGCATGCGGTCCATTCTTATTAAT
TGGATCGTCGACGTCCACGATCGCTTTCGCCTGCTTCCTGAGACTCTCTTCTTGGCAGTCAACTATATTGATCGC
TTCCTCTGTGGCAAGATTGTGTCGACGGCCAAATTGCAATTGGTGGGCGTTACGGCTCTTCTGGTAGCTACCAAG
TACGAGGAGATTAGTTGCCCCGAGATTCGCGAGATCGGTTCCGTTGTGGAGAATTGCTACTCGGATAATGATATC
ATCAAGGCCGAACGATACATGCTCACCATGCTCGGGTTTGAGCTGGGGTGGCCTGGGCCCTTGAACTTCTTGCGG
CGCATCAGCAAAGCCGATTCCTACGACGTGGAGACGAGAACAATGGCAAAATACTTTCTGGAATTGGCCCTCGTG
GATTATCGATTTGTTTCAACCCTGCCAAGCTATCTGGCGGCAGCGACCCACTGTTTGGCGATGCTGATTCTGGAG
AAGGGCTATTGGAAATTTCTACACGTTTACTATTCCGGTTTCACGTATCGCCAGCTACTGCCCGCTATCCAAACG
CTGTTGAACTGCTTGGAGAGACCACTTTGGCACCACGAGTCCGTCTTCACGAAGTATACCGAAGAGCGATTTCAA
TCGACATCTCTAGTGGTGCAAAGGGTGCTCTCAAGTGGCTTTGTGTTACCTAACCACCGCTACGTCGGAGGGCCG
GTGGCGTATCACGAGTAA
Gene >OphauG2|1630
ATGATAGCTAACAGTCATGCTACCGCGCATGATGGTCATACTGCTCTGATTCCCCTGCCTGCAAACCAAGAACAT
CTAGCAAACGATTGTGAAAGCTGCGACCTCGAAGTATGCCAAGACTGCGAGTTGAACTTGGAAGTTGATGACTCT
CGCCCCGTTCAAATCTACAGTCAAGGCAACGAGTCTCGAGATGAGCACGTCGGATACGAAGGCATAGAACTCTAC
ATGACCACTTATGATGGATTGCCTCCCAAGACGGTCCTTGACCCTACACACCCTGTGATCGCGCCTCGTCGCTAC
TCAGCCTGCGATCTTGAAGAGATCAACGCCGCAAAATTGGTGATTGGTGGAACCGTTGCGTACCAGGACCTCCTT
GACGACATGAGCGATCCATACATGGTGGCTGGATACAGCCAAGAGATATTTACGTACATGCACGAGCTCGAGGTC
AGTATCCCATGCAGTTGGGTGTTTTCAGCAACCAAGGGCAAAGTGGTTGATGAGCTAACGCAACCTTGTTTGATA
GACCAGGATGCTCCCCTATACTCACTACATGGATGGACAAGAGGAGGTGGATTGGCGCATGCGGTCCATTCTTAT
TAATTGGATCGTCGACGTCCACGATCGCTTTCGCCTGCTTCCTGAGACTCTCTTCTTGGCAGTCAACTATATTGA
TCGCTTCCTCTGTGGCAAGATTGTGTCGACGGCCAAATTGCAATTGGTGGGCGTTACGGCTCTTCTGGTAGCTAC
CAAGTACGAGGAGATTAGTTGCCCCGAGATTCGCGAGATCGGTTCCGTTGTGGAGAATTGCTACTCGGATAATGA
TATCATCAAGGCCGAACGATACATGCTCACCATGCTCGGGTTTGAGCTGGGGTGGCCTGGGCCCTTGAACTTCTT
GCGGCGCATCAGCAAAGCCGATTCCTACGACGTGGAGACGAGAACAATGGCAAAATACTTTCTGGAATTGGCCCT
CGTGGATTATCGATTTGTTTCAACCCTGCCAAGCTATCTGGCGGCAGCGACCCACTGTTTGGCGATGCTGATTCT
GGAGAAGGGCTATTGGGTATGATTTGGCGCCATTCATTGACTGACTAGTATTTGCTGACGGCGCGATAGAAATTT
CTACACGTTTACTATTCCGGTTTCACGTATCGCCAGCTACTGCCCGCTATCCAAACGCTGTTGAACTGCTTGGAG
AGACCACTTTGGCACCACGAGTCCGTCTTCACGAAGTATACCGAAGAGCGATTTCAATCGACATCTCTAGTGGTG
CAAAGGGTGCTCTCAAGTGGCTTTGTGTTACCTAACCACCGCTACGTCGGAGGGCCGGTGGCGTATCACGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail