Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1629
Gene name
LocationContig_150:8750..10962
Strand-
Gene length (bp)2212
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 4.1E-26 339 430
PF00153 Mito_carr Mitochondrial carrier protein 1.0E-18 434 522
PF00153 Mito_carr Mitochondrial carrier protein 1.8E-22 532 622
PF13499 EF-hand_7 EF-hand domain pair 1.3E-08 172 267
PF13405 EF-hand_6 EF-hand domain 2.5E-07 174 198
PF00036 EF-hand_1 EF hand 1.9E-07 174 198
PF13833 EF-hand_8 EF-hand domain pair 1.8E-03 98 127
PF13202 EF-hand_5 EF hand 2.3E-06 174 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 24 673 6.0E-164
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 38 619 5.0E-159
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 38 619 5.0E-159
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 38 619 6.0E-159
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 40 670 3.0E-157
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54RB9|CMC_DICDI Calcium-binding mitochondrial carrier protein OS=Dictyostelium discoideum GN=mcfO PE=3 SV=1 24 673 6.0E-164
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 38 619 5.0E-159
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 38 619 5.0E-159
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 38 619 6.0E-159
sp|Q9VA73|CMC_DROME Calcium-binding mitochondrial carrier protein Aralar1 OS=Drosophila melanogaster GN=aralar1 PE=2 SV=1 40 670 3.0E-157
sp|Q9UJS0|CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 39 690 3.0E-153
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 23 619 4.0E-153
sp|Q8HXW2|CMC2_MACFA Calcium-binding mitochondrial carrier protein Aralar2 OS=Macaca fascicularis GN=SLC25A13 PE=2 SV=1 70 619 5.0E-151
sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier K02F3.2 OS=Caenorhabditis elegans GN=K02F3.2 PE=3 SV=3 28 645 8.0E-129
sp|Q12482|AGC1_YEAST Mitochondrial aspartate-glutamate transporter AGC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGC1 PE=3 SV=1 299 634 5.0E-119
sp|Q75AH6|AGC1_ASHGO Mitochondrial aspartate-glutamate transporter AGC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGC1 PE=3 SV=2 299 625 6.0E-114
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 342 620 1.0E-70
sp|Q9D6M3|GHC1_MOUSE Mitochondrial glutamate carrier 1 OS=Mus musculus GN=Slc25a22 PE=1 SV=1 334 615 1.0E-56
sp|Q9H1K4|GHC2_HUMAN Mitochondrial glutamate carrier 2 OS=Homo sapiens GN=SLC25A18 PE=1 SV=1 337 617 1.0E-55
sp|Q9H936|GHC1_HUMAN Mitochondrial glutamate carrier 1 OS=Homo sapiens GN=SLC25A22 PE=1 SV=1 334 615 4.0E-55
sp|Q5RD81|GHC1_PONAB Mitochondrial glutamate carrier 1 OS=Pongo abelii GN=SLC25A22 PE=2 SV=1 334 615 5.0E-55
sp|Q08DK4|GHC1_BOVIN Mitochondrial glutamate carrier 1 OS=Bos taurus GN=SLC25A22 PE=2 SV=1 334 615 5.0E-55
sp|Q9DB41|GHC2_MOUSE Mitochondrial glutamate carrier 2 OS=Mus musculus GN=Slc25a18 PE=1 SV=4 337 615 2.0E-54
sp|Q505J6|GHC2_RAT Mitochondrial glutamate carrier 2 OS=Rattus norvegicus GN=Slc25a18 PE=2 SV=2 337 615 2.0E-53
sp|Q08DK7|MCATL_BOVIN Mitochondrial basic amino acids transporter OS=Bos taurus GN=SLC25A29 PE=2 SV=1 342 620 1.0E-36
sp|Q5HZE0|MCATL_RAT Mitochondrial basic amino acids transporter OS=Rattus norvegicus GN=Slc25a29 PE=2 SV=1 342 618 1.0E-35
sp|Q8BL03|MCATL_MOUSE Mitochondrial basic amino acids transporter OS=Mus musculus GN=Slc25a29 PE=1 SV=1 342 618 6.0E-35
sp|Q8N8R3|MCATL_HUMAN Mitochondrial basic amino acids transporter OS=Homo sapiens GN=SLC25A29 PE=1 SV=2 342 618 6.0E-33
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 346 622 6.0E-33
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 334 615 7.0E-33
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 335 615 7.0E-33
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 342 618 1.0E-32
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 342 622 2.0E-32
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 335 617 5.0E-32
sp|P97521|MCAT_RAT Mitochondrial carnitine/acylcarnitine carrier protein OS=Rattus norvegicus GN=Slc25a20 PE=1 SV=1 335 622 5.0E-32
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 357 619 9.0E-31
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 342 616 1.0E-30
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 335 617 1.0E-30
sp|Q8BZ09|ODC_MOUSE Mitochondrial 2-oxodicarboxylate carrier OS=Mus musculus GN=Slc25a21 PE=1 SV=1 338 616 2.0E-30
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 335 617 3.0E-30
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 342 615 1.0E-29
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 346 616 1.0E-29
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 343 618 2.0E-29
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 343 622 9.0E-29
sp|Q54BM3|MCFG_DICDI Mitochondrial substrate carrier family protein G OS=Dictyostelium discoideum GN=mcfG PE=2 SV=1 342 622 1.0E-28
sp|Q8N413|S2545_HUMAN Solute carrier family 25 member 45 OS=Homo sapiens GN=SLC25A45 PE=2 SV=2 342 618 2.0E-28
sp|Q6DHC3|S2540_DANRE Solute carrier family 25 member 40 OS=Danio rerio GN=slc25a40 PE=2 SV=1 341 616 2.0E-28
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 342 616 4.0E-28
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 335 619 5.0E-28
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 346 622 5.0E-28
sp|Q1ECW7|S247A_DANRE Solute carrier family 25 member 47-A OS=Danio rerio GN=slc25a47a PE=2 SV=1 342 617 5.0E-28
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 326 613 8.0E-28
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 333 619 9.0E-28
sp|Q6DJ08|S2538_XENTR Solute carrier family 25 member 38 OS=Xenopus tropicalis GN=slc25a38 PE=2 SV=1 343 622 2.0E-27
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 344 617 3.0E-27
sp|Q8BGP6|S2540_MOUSE Solute carrier family 25 member 40 OS=Mus musculus GN=Slc25a40 PE=1 SV=1 344 620 3.0E-27
sp|Q6DFK2|S2540_XENLA Solute carrier family 25 member 40 OS=Xenopus laevis GN=slc25a40 PE=2 SV=1 342 616 4.0E-27
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 348 619 6.0E-27
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 342 622 1.0E-26
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 344 606 1.0E-26
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 333 616 1.0E-26
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 338 618 1.0E-26
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 343 620 1.0E-26
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 344 616 2.0E-26
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 343 622 3.0E-26
sp|Q01356|ARG13_NEUCR Amino-acid transporter arg-13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-13 PE=2 SV=1 318 624 3.0E-26
sp|Q55E85|MCFD_DICDI Mitochondrial substrate carrier family protein D OS=Dictyostelium discoideum GN=mcfD PE=3 SV=1 342 622 8.0E-26
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 342 617 1.0E-25
sp|Q91XD8|S2538_MOUSE Solute carrier family 25 member 38 OS=Mus musculus GN=Slc25a38 PE=2 SV=1 343 622 1.0E-25
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 344 616 1.0E-25
sp|Q5RFB7|ODC_PONAB Mitochondrial 2-oxodicarboxylate carrier OS=Pongo abelii GN=SLC25A21 PE=2 SV=1 338 620 2.0E-25
sp|Q6ZT89|S2548_HUMAN Solute carrier family 25 member 48 OS=Homo sapiens GN=SLC25A48 PE=1 SV=2 342 621 2.0E-25
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 357 618 2.0E-25
sp|Q9LJX5|BRTL1_ARATH Probable mitochondrial adenine nucleotide transporter BTL1 OS=Arabidopsis thaliana GN=At3g20240 PE=2 SV=1 342 622 2.0E-25
sp|Q499U1|S2538_RAT Solute carrier family 25 member 38 OS=Rattus norvegicus GN=Slc25a38 PE=2 SV=2 343 622 3.0E-25
sp|Q9FHX2|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic OS=Arabidopsis thaliana GN=MFL1 PE=2 SV=1 352 605 3.0E-25
sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier OS=Homo sapiens GN=SLC25A21 PE=1 SV=1 338 620 4.0E-25
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 358 618 4.0E-25
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 346 616 4.0E-25
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 346 616 6.0E-25
sp|Q54W11|MCFL_DICDI Mitochondrial substrate carrier family protein L OS=Dictyostelium discoideum GN=mcfL PE=3 SV=1 338 624 6.0E-25
sp|Q12375|ORT1_YEAST Mitochondrial ornithine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORT1 PE=1 SV=2 325 621 7.0E-25
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 343 622 9.0E-25
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 341 622 9.0E-25
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 343 616 1.0E-24
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 346 624 2.0E-24
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 340 622 3.0E-24
sp|B0G143|UCPB_DICDI Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1 343 621 3.0E-24
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 380 616 3.0E-24
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 304 602 4.0E-24
sp|B2MVX9|S2538_SHEEP Solute carrier family 25 member 38 OS=Ovis aries GN=SLC25A38 PE=2 SV=1 343 622 4.0E-24
sp|Q9CA93|BAC2_ARATH Mitochondrial arginine transporter BAC2 OS=Arabidopsis thaliana GN=BAC2 PE=1 SV=1 358 617 5.0E-24
sp|P40556|YIA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIA6 PE=1 SV=1 345 620 5.0E-24
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 342 618 6.0E-24
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 348 622 8.0E-24
sp|Q5EAC0|S2538_BOVIN Solute carrier family 25 member 38 OS=Bos taurus GN=SLC25A38 PE=2 SV=2 343 622 1.0E-23
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 340 616 2.0E-23
sp|Q12289|CRC1_YEAST Mitochondrial carnitine carrier OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRC1 PE=1 SV=1 334 621 2.0E-23
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 342 621 2.0E-23
sp|Q9D8K8|S2539_MOUSE Solute carrier family 25 member 39 OS=Mus musculus GN=Slc25a39 PE=2 SV=1 380 616 2.0E-23
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 343 622 2.0E-23
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 342 602 4.0E-23
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 338 618 4.0E-23
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 348 618 7.0E-23
sp|Q6DHS9|S2548_DANRE Solute carrier family 25 member 48 OS=Danio rerio GN=slc25a48 PE=2 SV=1 342 617 1.0E-22
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 333 604 1.0E-22
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 380 616 1.0E-22
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 346 616 2.0E-22
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 343 621 2.0E-22
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 380 616 2.0E-22
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 346 616 3.0E-22
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 346 616 4.0E-22
sp|Q944H5|MTM1_ARATH Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 380 622 4.0E-22
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 434 621 4.0E-22
sp|Q9BZJ4|S2539_HUMAN Solute carrier family 25 member 39 OS=Homo sapiens GN=SLC25A39 PE=2 SV=2 380 616 4.0E-22
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 423 620 1.0E-21
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 346 618 1.0E-21
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 346 618 1.0E-21
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 434 621 1.0E-21
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 342 616 1.0E-21
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 343 619 2.0E-21
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 343 621 2.0E-21
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 343 621 2.0E-21
sp|Q6IS41|S2547_MOUSE Solute carrier family 25 member 47 OS=Mus musculus GN=Slc25a47 PE=2 SV=2 342 618 3.0E-21
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 341 616 3.0E-21
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 434 621 3.0E-21
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 344 617 3.0E-21
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 346 630 3.0E-21
sp|Q54FE6|MCFS_DICDI Mitochondrial substrate carrier family protein S OS=Dictyostelium discoideum GN=mcfS PE=3 SV=1 344 622 3.0E-21
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 342 607 4.0E-21
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 346 618 4.0E-21
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 342 616 4.0E-21
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 346 622 5.0E-21
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 342 616 5.0E-21
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 343 619 5.0E-21
sp|O97470|ADT_DICDI Mitochondrial substrate carrier family protein ancA OS=Dictyostelium discoideum GN=ancA PE=1 SV=1 344 629 5.0E-21
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 346 616 6.0E-21
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 342 616 6.0E-21
sp|Q5RD67|S2544_PONAB Solute carrier family 25 member 44 OS=Pongo abelii GN=SLC25A44 PE=2 SV=2 357 632 6.0E-21
sp|Q8BGF9|S2544_MOUSE Solute carrier family 25 member 44 OS=Mus musculus GN=Slc25a44 PE=1 SV=1 357 632 7.0E-21
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 346 618 7.0E-21
sp|P12236|ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 335 622 7.0E-21
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 342 619 1.0E-20
sp|A0JN87|ODC_BOVIN Mitochondrial 2-oxodicarboxylate carrier OS=Bos taurus GN=SLC25A21 PE=2 SV=1 338 620 1.0E-20
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 343 621 1.0E-20
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 343 621 1.0E-20
sp|Q4V9P0|SAMC_DANRE S-adenosylmethionine mitochondrial carrier protein OS=Danio rerio GN=slc25a26 PE=2 SV=1 338 616 1.0E-20
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 343 621 1.0E-20
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 342 618 1.0E-20
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 346 618 2.0E-20
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 343 616 2.0E-20
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 348 603 2.0E-20
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 431 620 2.0E-20
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 346 618 2.0E-20
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 342 596 2.0E-20
sp|Q9WVD5|ORNT1_MOUSE Mitochondrial ornithine transporter 1 OS=Mus musculus GN=Slc25a15 PE=1 SV=1 334 622 2.0E-20
sp|Q96H78|S2544_HUMAN Solute carrier family 25 member 44 OS=Homo sapiens GN=SLC25A44 PE=2 SV=1 357 632 2.0E-20
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 431 660 3.0E-20
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 440 688 4.0E-20
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 342 596 4.0E-20
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 334 529 5.0E-20
sp|Q5U3V7|S2543_DANRE Solute carrier family 25 member 43 OS=Danio rerio GN=slc25a43 PE=2 SV=1 337 621 5.0E-20
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 342 619 6.0E-20
sp|P38152|TXTP_YEAST Tricarboxylate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTP1 PE=2 SV=3 341 616 6.0E-20
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 98 529 7.0E-20
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 342 619 7.0E-20
sp|Q9BXI2|ORNT2_HUMAN Mitochondrial ornithine transporter 2 OS=Homo sapiens GN=SLC25A2 PE=1 SV=3 336 622 7.0E-20
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 421 620 7.0E-20
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 343 616 8.0E-20
sp|Q9Z2Z6|MCAT_MOUSE Mitochondrial carnitine/acylcarnitine carrier protein OS=Mus musculus GN=Slc25a20 PE=1 SV=1 440 621 9.0E-20
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 431 620 1.0E-19
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 342 622 1.0E-19
sp|Q9UTN1|OAC1_SCHPO Mitochondrial oxaloacetate transport protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oac1 PE=3 SV=1 335 616 1.0E-19
sp|Q6QRN9|ADT3_PIG ADP/ATP translocase 3 OS=Sus scrofa GN=SLC25A6 PE=2 SV=3 335 622 1.0E-19
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 342 619 2.0E-19
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 346 622 2.0E-19
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 346 616 2.0E-19
sp|P32007|ADT3_BOVIN ADP/ATP translocase 3 OS=Bos taurus GN=SLC25A6 PE=1 SV=3 335 622 2.0E-19
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 342 622 2.0E-19
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 342 619 2.0E-19
sp|P31692|ADT_PARKE ADP,ATP carrier protein OS=Parachlorella kessleri PE=3 SV=1 342 622 2.0E-19
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 334 619 3.0E-19
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 421 620 3.0E-19
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 346 625 3.0E-19
sp|Q6Q0C1|S2547_HUMAN Solute carrier family 25 member 47 OS=Homo sapiens GN=SLC25A47 PE=2 SV=1 342 618 3.0E-19
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 346 616 3.0E-19
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 336 632 3.0E-19
sp|Q9Y619|ORNT1_HUMAN Mitochondrial ornithine transporter 1 OS=Homo sapiens GN=SLC25A15 PE=1 SV=1 334 622 4.0E-19
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 342 622 4.0E-19
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 346 616 4.0E-19
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 359 522 5.0E-19
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 431 620 5.0E-19
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 431 660 5.0E-19
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 344 622 5.0E-19
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 441 620 5.0E-19
sp|Q7T292|MFRN2_DANRE Mitoferrin-2 OS=Danio rerio GN=slc25a28 PE=2 SV=1 339 622 5.0E-19
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 342 616 5.0E-19
sp|Q9VQG4|COLT_DROME Congested-like trachea protein OS=Drosophila melanogaster GN=colt PE=2 SV=1 442 621 6.0E-19
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 342 619 6.0E-19
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 344 622 6.0E-19
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 344 617 6.0E-19
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 343 616 6.0E-19
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 435 620 6.0E-19
sp|O43772|MCAT_HUMAN Mitochondrial carnitine/acylcarnitine carrier protein OS=Homo sapiens GN=SLC25A20 PE=1 SV=1 440 621 7.0E-19
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 342 619 7.0E-19
sp|P29518|BT1_MAIZE Adenine nucleotide transporter BT1, chloroplastic/amyloplastic/mitochondrial OS=Zea mays GN=BT1 PE=1 SV=1 343 622 7.0E-19
sp|Q96A46|MFRN2_HUMAN Mitoferrin-2 OS=Homo sapiens GN=SLC25A28 PE=2 SV=1 340 622 7.0E-19
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 436 620 8.0E-19
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 337 631 8.0E-19
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 346 618 8.0E-19
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 342 622 9.0E-19
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 342 622 9.0E-19
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 434 621 9.0E-19
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 436 660 9.0E-19
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 334 619 1.0E-18
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 346 616 1.0E-18
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 334 619 1.0E-18
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 334 619 1.0E-18
sp|Q09461|YQ51_CAEEL Uncharacterized mitochondrial carrier C16C10.1 OS=Caenorhabditis elegans GN=C16C10.1 PE=3 SV=2 344 619 1.0E-18
sp|Q8HXY2|MCAT_MACFA Mitochondrial carnitine/acylcarnitine carrier protein OS=Macaca fascicularis GN=SLC25A20 PE=2 SV=1 440 621 2.0E-18
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 339 522 2.0E-18
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 346 620 2.0E-18
sp|Q10442|YDE9_SCHPO Uncharacterized mitochondrial carrier C12B10.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.09 PE=3 SV=1 346 626 2.0E-18
sp|Q6DE75|S2538_XENLA Solute carrier family 25 member 38 OS=Xenopus laevis GN=slc25a38 PE=2 SV=1 442 648 3.0E-18
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 436 620 3.0E-18
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 436 620 3.0E-18
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 342 622 3.0E-18
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 346 622 3.0E-18
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 334 619 4.0E-18
sp|Q9H0C2|ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 322 605 5.0E-18
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 348 617 5.0E-18
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 334 619 5.0E-18
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 334 619 5.0E-18
sp|A3KPP4|S2535_DANRE Solute carrier family 25 member 35 OS=Danio rerio GN=slc25a35 PE=2 SV=1 342 607 5.0E-18
sp|Q4R8M0|ADT4_MACFA ADP/ATP translocase 4 OS=Macaca fascicularis GN=SLC25A31 PE=2 SV=1 322 605 6.0E-18
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 334 619 6.0E-18
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 342 619 6.0E-18
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 337 521 8.0E-18
sp|P04710|ADT1_YEAST ADP,ATP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC1 PE=1 SV=1 323 622 8.0E-18
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 342 605 8.0E-18
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 333 616 1.0E-17
sp|Q8R0Z5|MFRN2_MOUSE Mitoferrin-2 OS=Mus musculus GN=Slc25a28 PE=2 SV=1 340 622 1.0E-17
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 346 619 1.0E-17
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 342 622 1.0E-17
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 346 619 1.0E-17
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 342 605 1.0E-17
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 339 622 1.0E-17
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 334 619 1.0E-17
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 417 660 1.0E-17
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 418 620 1.0E-17
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 343 521 2.0E-17
sp|Q2HFL6|TPC1_CHAGB Mitochondrial thiamine pyrophosphate carrier 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TPC1 PE=3 SV=2 346 616 2.0E-17
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 334 619 2.0E-17
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 344 622 2.0E-17
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 344 622 2.0E-17
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 417 660 2.0E-17
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 337 521 3.0E-17
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 343 521 3.0E-17
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 418 620 3.0E-17
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 322 619 3.0E-17
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 346 622 3.0E-17
sp|Q18P97|UCP1_SUNMU Mitochondrial brown fat uncoupling protein 1 OS=Suncus murinus GN=UCP1 PE=2 SV=1 348 603 3.0E-17
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 344 618 4.0E-17
sp|Q86I81|MCFI_DICDI Mitochondrial substrate carrier family protein I OS=Dictyostelium discoideum GN=mcfI PE=2 SV=1 322 622 4.0E-17
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 343 521 5.0E-17
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 349 616 5.0E-17
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 431 621 6.0E-17
sp|Q9M024|TAAC_ARATH Thylakoid ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=TAAC PE=1 SV=1 359 622 7.0E-17
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 346 622 7.0E-17
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 346 622 7.0E-17
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 355 603 8.0E-17
sp|Q55DY8|MFRN_DICDI Mitoferrin OS=Dictyostelium discoideum GN=mcfF PE=3 SV=1 425 622 9.0E-17
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 337 521 9.0E-17
sp|Q9W720|UCP2_DANRE Mitochondrial uncoupling protein 2 OS=Danio rerio GN=ucp2 PE=2 SV=1 339 622 9.0E-17
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 348 603 9.0E-17
sp|Q76PC3|YQ73_SCHPO Uncharacterized mitochondrial carrier C1442.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.03 PE=3 SV=1 437 621 1.0E-16
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 343 521 1.0E-16
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 342 618 1.0E-16
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 344 622 1.0E-16
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 339 622 1.0E-16
sp|P16261|GDC_RAT Graves disease carrier protein (Fragment) OS=Rattus norvegicus GN=Slc25a16 PE=2 SV=1 342 607 2.0E-16
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 343 521 2.0E-16
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 342 620 2.0E-16
sp|Q5U680|SAMC_MOUSE S-adenosylmethionine mitochondrial carrier protein OS=Mus musculus GN=Slc25a26 PE=1 SV=2 340 622 2.0E-16
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 339 622 2.0E-16
sp|Q9W725|UCP2_CYPCA Mitochondrial uncoupling protein 2 OS=Cyprinus carpio GN=ucp2 PE=2 SV=1 339 622 2.0E-16
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 348 603 2.0E-16
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 435 660 2.0E-16
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 343 607 2.0E-16
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 339 622 2.0E-16
sp|Q5SWT3|S2535_MOUSE Solute carrier family 25 member 35 OS=Mus musculus GN=Slc25a35 PE=1 SV=2 342 620 2.0E-16
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 346 619 2.0E-16
sp|O60029|PET8_ASHGO Putative mitochondrial carrier protein PET8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PET8 PE=3 SV=1 337 621 2.0E-16
sp|P31691|ADT_ORYSJ ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 342 619 2.0E-16
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 343 607 2.0E-16
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 430 625 3.0E-16
sp|Q54MZ4|MCFB_DICDI Mitochondrial substrate carrier family protein B OS=Dictyostelium discoideum GN=mcfB PE=3 SV=1 441 619 3.0E-16
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 343 521 3.0E-16
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 343 521 3.0E-16
sp|Q9P7X9|YH66_SCHPO Uncharacterized mitochondrial carrier P23A10.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP23A10.06 PE=3 SV=1 348 617 3.0E-16
sp|P31167|ADT1_ARATH ADP,ATP carrier protein 1, mitochondrial OS=Arabidopsis thaliana GN=AAC1 PE=1 SV=2 302 636 3.0E-16
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 348 603 3.0E-16
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 339 622 3.0E-16
sp|Q08CI8|S238A_DANRE Solute carrier family 25 member 38-A OS=Danio rerio GN=slc25a38a PE=2 SV=2 442 623 4.0E-16
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 343 521 4.0E-16
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 346 616 4.0E-16
sp|P53320|MTM1_YEAST Mitochondrial carrier protein MTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTM1 PE=1 SV=1 380 621 4.0E-16
sp|Q54BF6|MCFN_DICDI Mitochondrial substrate carrier family protein N OS=Dictyostelium discoideum GN=mcfN PE=1 SV=2 356 600 4.0E-16
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 339 622 5.0E-16
sp|Q41629|ADT1_WHEAT ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 342 619 6.0E-16
sp|B0DK57|S2538_LACBS Solute carrier family 25 member 38 homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_191230 PE=3 SV=1 346 616 7.0E-16
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 346 629 7.0E-16
sp|Q20799|CMC2_CAEEL Putative calcium-binding mitochondrial carrier F55A11.4 OS=Caenorhabditis elegans GN=F55A11.4 PE=5 SV=1 168 645 8.0E-16
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 344 616 8.0E-16
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 348 603 8.0E-16
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 348 603 9.0E-16
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 346 616 9.0E-16
sp|P04709|ADT1_MAIZE ADP,ATP carrier protein 1, mitochondrial OS=Zea mays GN=ANT1 PE=2 SV=3 342 619 9.0E-16
sp|P0CAT2|S238B_DANRE Solute carrier family 25 member 38-B OS=Danio rerio GN=slc25a38b PE=3 SV=2 442 648 1.0E-15
sp|Q96DW6|S2538_HUMAN Solute carrier family 25 member 38 OS=Homo sapiens GN=SLC25A38 PE=1 SV=1 442 623 1.0E-15
sp|O22342|ADT1_GOSHI ADP,ATP carrier protein 1, mitochondrial OS=Gossypium hirsutum GN=ANT1 PE=2 SV=1 314 636 1.0E-15
sp|Q9FM86|ADT5_ARATH Probable ADP,ATP carrier protein At5g56450 OS=Arabidopsis thaliana GN=At5g56450 PE=2 SV=1 342 605 1.0E-15
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 342 607 1.0E-15
sp|P12857|ADT2_MAIZE ADP,ATP carrier protein 2, mitochondrial OS=Zea mays GN=ANT2 PE=2 SV=2 342 619 1.0E-15
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 339 622 1.0E-15
sp|A6SL61|TPC1_BOTFB Mitochondrial thiamine pyrophosphate carrier 1 OS=Botryotinia fuckeliana (strain B05.10) GN=tpc1 PE=3 SV=1 439 687 2.0E-15
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 442 622 2.0E-15
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 342 622 2.0E-15
sp|Q8N5S1|S2541_HUMAN Solute carrier family 25 member 41 OS=Homo sapiens GN=SLC25A41 PE=2 SV=2 338 622 2.0E-15
sp|P27080|ADT_CHLRE ADP,ATP carrier protein OS=Chlamydomonas reinhardtii GN=ABT PE=2 SV=1 342 622 2.0E-15
sp|O65023|EAAC_ARATH Probable envelope ADP,ATP carrier protein, chloroplastic OS=Arabidopsis thaliana GN=EAAC PE=2 SV=2 359 622 2.0E-15
sp|A4RPU0|S2538_MAGO7 Solute carrier family 25 member 38 homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05623 PE=3 SV=1 341 618 2.0E-15
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 440 619 2.0E-15
sp|P38087|YMC2_YEAST Carrier protein YMC2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC2 PE=1 SV=1 325 618 2.0E-15
sp|Q6GLA2|SAMC_XENTR S-adenosylmethionine mitochondrial carrier protein OS=Xenopus tropicalis GN=slc25a26 PE=2 SV=1 338 622 2.0E-15
sp|Q8K404|UCP1_DICGR Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 348 603 2.0E-15
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 439 683 3.0E-15
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 342 622 3.0E-15
sp|A6QR09|SAMC_BOVIN S-adenosylmethionine mitochondrial carrier protein OS=Bos taurus GN=SLC25A26 PE=2 SV=1 340 596 3.0E-15
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 338 520 4.0E-15
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 348 603 4.0E-15
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 341 622 5.0E-15
sp|Q41630|ADT2_WHEAT ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1 342 619 5.0E-15
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 339 616 5.0E-15
sp|Q03829|YM39_YEAST Uncharacterized mitochondrial carrier YMR166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR166C PE=1 SV=1 425 616 6.0E-15
sp|Q27238|ADT1_ANOGA ADP,ATP carrier protein 1 OS=Anopheles gambiae GN=AGAP006782 PE=2 SV=2 342 605 6.0E-15
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 348 617 6.0E-15
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 359 618 7.0E-15
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 441 605 8.0E-15
sp|P10861|UCP1_BOVIN Mitochondrial brown fat uncoupling protein 1 (Fragment) OS=Bos taurus GN=UCP1 PE=2 SV=2 348 603 9.0E-15
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 346 524 9.0E-15
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 342 619 1.0E-14
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 342 622 1.0E-14
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 343 596 1.0E-14
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 346 622 1.0E-14
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 346 622 1.0E-14
sp|Q9VBN7|SAMC_DROME S-adenosylmethionine mitochondrial carrier protein homolog OS=Drosophila melanogaster GN=CG4743 PE=2 SV=2 333 632 1.0E-14
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 443 619 2.0E-14
sp|O97562|UCP2_PIG Mitochondrial uncoupling protein 2 OS=Sus scrofa GN=UCP2 PE=2 SV=1 346 532 2.0E-14
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 435 621 2.0E-14
sp|Q4WQC5|S2538_ASPFU Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12340 PE=3 SV=1 336 618 2.0E-14
sp|B0Y4J4|S2538_ASPFC Solute carrier family 25 member 38 homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_069300 PE=3 SV=1 336 618 2.0E-14
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 344 622 2.0E-14
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 346 618 2.0E-14
sp|P40941|ADT2_ARATH ADP,ATP carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=AAC2 PE=2 SV=2 317 636 2.0E-14
sp|O22261|NDT1_ARATH Nicotinamide adenine dinucleotide transporter 1, chloroplastic OS=Arabidopsis thaliana GN=NDT1 PE=1 SV=2 359 536 3.0E-14
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 342 619 3.0E-14
sp|Q54DU1|MCFP_DICDI Mitochondrial substrate carrier family protein P OS=Dictyostelium discoideum GN=mcfP PE=3 SV=1 442 624 3.0E-14
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 343 622 3.0E-14
sp|Q26365|ADT_DROME ADP,ATP carrier protein OS=Drosophila melanogaster GN=sesB PE=2 SV=4 342 622 3.0E-14
sp|Q06497|ANT1_YEAST Peroxisomal adenine nucleotide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ANT1 PE=1 SV=1 346 596 3.0E-14
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 349 622 3.0E-14
sp|Q7PQV7|ADT2_ANOGA ADP,ATP carrier protein 2 OS=Anopheles gambiae GN=AGAP002358 PE=3 SV=2 342 622 3.0E-14
sp|Q9SJY5|PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 343 621 3.0E-14
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 342 622 4.0E-14
sp|A1CWA4|S2538_NEOFI Solute carrier family 25 member 38 homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_103940 PE=3 SV=1 341 618 4.0E-14
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 342 619 5.0E-14
sp|A6RAY2|S2538_AJECN Solute carrier family 25 member 38 homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06120 PE=3 SV=1 341 618 5.0E-14
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 339 603 5.0E-14
sp|Q628Z2|CMC3_CAEBR Probable calcium-binding mitochondrial carrier CBG00135 OS=Caenorhabditis briggsae GN=CBG00135 PE=3 SV=1 172 616 6.0E-14
sp|Q09188|ADT_SCHPO ADP,ATP carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anc1 PE=2 SV=1 341 622 6.0E-14
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 342 616 6.0E-14
sp|Q9N2J1|UCP2_CANLF Mitochondrial uncoupling protein 2 OS=Canis lupus familiaris GN=UCP2 PE=2 SV=1 346 532 7.0E-14
sp|P49382|ADT_KLULA ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 342 622 7.0E-14
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 435 621 7.0E-14
sp|O49447|ADT3_ARATH ADP,ATP carrier protein 3, mitochondrial OS=Arabidopsis thaliana GN=AAC3 PE=2 SV=1 342 636 8.0E-14
sp|P56500|UCP2_RAT Mitochondrial uncoupling protein 2 OS=Rattus norvegicus GN=Ucp2 PE=2 SV=1 346 532 9.0E-14
sp|O04200|PXN_ARATH Peroxisomal nicotinamide adenine dinucleotide carrier OS=Arabidopsis thaliana GN=PXN PE=1 SV=1 355 604 9.0E-14
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 342 619 1.0E-13
sp|P70406|UCP2_MOUSE Mitochondrial uncoupling protein 2 OS=Mus musculus GN=Ucp2 PE=1 SV=1 346 532 1.0E-13
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 329 517 1.0E-13
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 444 619 1.0E-13
sp|Q70HW3|SAMC_HUMAN S-adenosylmethionine mitochondrial carrier protein OS=Homo sapiens GN=SLC25A26 PE=2 SV=1 343 622 1.0E-13
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 332 517 1.0E-13
sp|A1CIF6|S2538_ASPCL Solute carrier family 25 member 38 homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_051330 PE=3 SV=1 341 618 1.0E-13
sp|P97700|M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 342 607 1.0E-13
sp|Q7XA87|FOLT1_ARATH Folate transporter 1, chloroplastic OS=Arabidopsis thaliana GN=FOLT1 PE=2 SV=1 349 520 2.0E-13
sp|Q54PY7|M2OM_DICDI Probable mitochondrial 2-oxoglutarate/malate carrier protein OS=Dictyostelium discoideum GN=ucpC PE=3 SV=1 440 622 2.0E-13
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 441 683 2.0E-13
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 337 524 2.0E-13
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 339 622 2.0E-13
sp|A2Q9F0|S2538_ASPNC Solute carrier family 25 member 38 homolog OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g07650 PE=3 SV=1 341 618 2.0E-13
sp|P56501|UCP3_MOUSE Mitochondrial uncoupling protein 3 OS=Mus musculus GN=Ucp3 PE=1 SV=1 339 622 2.0E-13
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 333 517 3.0E-13
sp|A4RF23|TPC1_MAGO7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TPC1 PE=3 SV=2 342 532 3.0E-13
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 342 619 3.0E-13
sp|Q5R5A8|UCP2_PONAB Mitochondrial uncoupling protein 2 OS=Pongo abelii GN=UCP2 PE=2 SV=1 346 532 3.0E-13
sp|Q3SZI5|UCP2_BOVIN Mitochondrial uncoupling protein 2 OS=Bos taurus GN=UCP2 PE=2 SV=1 346 532 3.0E-13
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 342 623 3.0E-13
sp|Q8VEM8|MPCP_MOUSE Phosphate carrier protein, mitochondrial OS=Mus musculus GN=Slc25a3 PE=1 SV=1 357 602 3.0E-13
sp|Q8CFJ7|S2545_MOUSE Solute carrier family 25 member 45 OS=Mus musculus GN=Slc25a45 PE=1 SV=1 439 641 4.0E-13
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 342 619 4.0E-13
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 342 619 4.0E-13
sp|P55851|UCP2_HUMAN Mitochondrial uncoupling protein 2 OS=Homo sapiens GN=UCP2 PE=1 SV=1 346 532 4.0E-13
sp|P27081|ADT2_SOLTU ADP,ATP carrier protein, mitochondrial (Fragment) OS=Solanum tuberosum GN=ANT1 PE=2 SV=1 342 636 4.0E-13
sp|P25083|ADT1_SOLTU ADP,ATP carrier protein, mitochondrial OS=Solanum tuberosum GN=ANT PE=2 SV=1 342 622 4.0E-13
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 327 522 5.0E-13
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 281 517 5.0E-13
sp|P0C582|M2OM_NEUCR Putative mitochondrial 2-oxoglutarate/malate carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mic-33 PE=3 SV=1 336 618 5.0E-13
sp|Q6FTE5|TPC1_CANGA Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TPC1 PE=3 SV=1 334 620 5.0E-13
sp|Q4PDL5|S2538_USTMA Solute carrier family 25 member 38 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10880 PE=3 SV=2 444 636 5.0E-13
sp|P56499|UCP3_RAT Mitochondrial uncoupling protein 3 OS=Rattus norvegicus GN=Ucp3 PE=2 SV=1 339 622 5.0E-13
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 327 522 6.0E-13
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 444 619 6.0E-13
sp|Q641C8|SAMC_XENLA S-adenosylmethionine mitochondrial carrier protein OS=Xenopus laevis GN=slc25a26 PE=2 SV=1 338 620 6.0E-13
sp|Q23125|MFRN_CAEEL Mitoferrin OS=Caenorhabditis elegans GN=W02B12.9 PE=3 SV=1 342 626 6.0E-13
sp|Q10248|YD1K_SCHPO Uncharacterized mitochondrial carrier C4G9.20c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.20c PE=3 SV=2 343 524 8.0E-13
sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier F17E5.2 OS=Caenorhabditis elegans GN=F17E5.2 PE=3 SV=4 342 616 8.0E-13
sp|P40035|PIC2_YEAST Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIC2 PE=1 SV=1 357 625 9.0E-13
sp|B2VSU4|S2538_PYRTR Solute carrier family 25 member 38 homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_00728 PE=3 SV=1 335 618 9.0E-13
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 390 621 9.0E-13
sp|Q9P6L7|YKQ9_SCHPO Uncharacterized mitochondrial carrier C688.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.09 PE=3 SV=1 332 517 1.0E-12
sp|Q9VAY3|MFRN_DROME Mitoferrin OS=Drosophila melanogaster GN=mfrn PE=2 SV=1 438 622 1.0E-12
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 441 656 1.0E-12
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 439 619 1.0E-12
sp|Q620A6|MFRN_CAEBR Mitoferrin OS=Caenorhabditis briggsae GN=CBG02884 PE=3 SV=1 356 626 1.0E-12
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 346 618 1.0E-12
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 441 641 2.0E-12
sp|A1DI57|TPC1_NEOFI Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tpc1 PE=3 SV=1 441 635 2.0E-12
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 441 633 2.0E-12
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 441 635 2.0E-12
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 441 635 2.0E-12
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 346 619 2.0E-12
sp|Q0P483|S2542_DANRE Mitochondrial coenzyme A transporter SLC25A42 OS=Danio rerio GN=slc25a42 PE=2 SV=1 342 622 2.0E-12
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 388 624 2.0E-12
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 438 625 2.0E-12
sp|Q6CNY8|S2538_KLULA Solute carrier family 25 member 38 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E08911g PE=3 SV=1 333 616 2.0E-12
sp|Q5B717|S2538_EMENI Solute carrier family 25 member 38 homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3663 PE=3 SV=2 333 618 2.0E-12
sp|Q27257|DIF1_CAEEL Protein dif-1 OS=Caenorhabditis elegans GN=dif-1 PE=2 SV=1 442 619 3.0E-12
sp|Q6DG32|S2536_DANRE Solute carrier family 25 member 36-A OS=Danio rerio GN=slc25a36a PE=2 SV=1 440 599 3.0E-12
sp|Q54VX4|MCFJ_DICDI Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum GN=mcfJ PE=2 SV=1 457 622 3.0E-12
sp|Q1E7P0|TPC1_COCIM Mitochondrial thiamine pyrophosphate carrier 1 OS=Coccidioides immitis (strain RS) GN=TPC1 PE=3 SV=1 441 635 3.0E-12
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 439 621 3.0E-12
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 343 622 3.0E-12
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 431 617 3.0E-12
sp|A7TIQ0|S2538_VANPO Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 348 618 3.0E-12
sp|Q0CT66|S2538_ASPTN Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 341 618 3.0E-12
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 338 519 4.0E-12
sp|Q7S2H8|TPC1_NEUCR Mitochondrial thiamine pyrophosphate carrier 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tpc-1 PE=3 SV=1 443 635 4.0E-12
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 439 621 4.0E-12
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 443 599 5.0E-12
sp|P02723|ADT_NEUCR ADP,ATP carrier protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aac PE=3 SV=1 342 527 5.0E-12
sp|Q9P7V8|MPCP_SCHPO Probable mitochondrial phosphate carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1703.13c PE=3 SV=1 357 602 5.0E-12
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 342 621 5.0E-12
sp|P39953|YEA6_YEAST Mitochondrial nicotinamide adenine dinucleotide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA6 PE=1 SV=1 349 522 6.0E-12
sp|Q55GE2|ODC_DICDI Probable mitochondrial 2-oxodicarboxylate carrier OS=Dictyostelium discoideum GN=mcfT PE=3 SV=1 245 424 6.0E-12
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 455 631 7.0E-12
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 410 616 7.0E-12
sp|Q55E45|MCFE_DICDI Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum GN=mcfE PE=3 SV=1 441 622 8.0E-12
sp|A2R5A0|TPC1_ASPNC Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tpc1 PE=3 SV=1 339 517 8.0E-12
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 443 599 8.0E-12
sp|O95847|UCP4_HUMAN Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=2 SV=1 342 621 8.0E-12
sp|Q9CR58|KMCP1_MOUSE Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1 342 522 9.0E-12
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 342 522 1.0E-11
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 341 522 1.0E-11
sp|Q4X022|TPC1_ASPFU Mitochondrial thiamine pyrophosphate carrier 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tpc1 PE=3 SV=3 333 517 1.0E-11
sp|Q6CQR3|TPC1_KLULA Mitochondrial thiamine pyrophosphate carrier 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TPC1 PE=3 SV=1 420 639 1.0E-11
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 342 532 1.0E-11
sp|Q74Z23|S2538_ASHGO Solute carrier family 25 member 38 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR383W PE=3 SV=1 440 623 1.0E-11
sp|Q2UU67|S2538_ASPOR Solute carrier family 25 member 38 homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090009000436 PE=3 SV=1 341 618 1.0E-11
sp|A5D9W9|S2538_PICGU Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 339 618 1.0E-11
sp|O59674|YB8B_SCHPO Uncharacterized mitochondrial carrier C29A3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A3.11c PE=3 SV=1 346 564 1.0E-11
sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=1 SV=2 455 631 2.0E-11
sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1 455 631 2.0E-11
sp|Q922G0|S2536_MOUSE Solute carrier family 25 member 36 OS=Mus musculus GN=Slc25a36 PE=2 SV=1 443 599 2.0E-11
sp|Q6BPW0|TPC1_DEBHA Mitochondrial thiamine pyrophosphate carrier 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TPC1 PE=3 SV=3 441 617 2.0E-11
sp|P23500|MRS4_YEAST Mitochondrial RNA-splicing protein MRS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS4 PE=1 SV=1 440 616 2.0E-11
sp|P38127|RIM2_YEAST Mitochondrial carrier protein RIM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM2 PE=3 SV=1 359 522 2.0E-11
sp|O97649|UCP3_PIG Mitochondrial uncoupling protein 3 OS=Sus scrofa GN=UCP3 PE=2 SV=1 340 522 2.0E-11
sp|O43808|PM34_HUMAN Peroxisomal membrane protein PMP34 OS=Homo sapiens GN=SLC25A17 PE=1 SV=1 340 620 2.0E-11
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 437 596 2.0E-11
sp|P16036|MPCP_RAT Phosphate carrier protein, mitochondrial OS=Rattus norvegicus GN=Slc25a3 PE=1 SV=1 357 602 2.0E-11
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 437 596 2.0E-11
sp|P10566|MRS3_YEAST Mitochondrial RNA-splicing protein MRS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRS3 PE=1 SV=4 439 616 3.0E-11
sp|Q9N2I9|UCP3_CANLF Mitochondrial uncoupling protein 3 OS=Canis lupus familiaris GN=UCP3 PE=2 SV=1 340 522 3.0E-11
sp|O77792|UCP3_BOVIN Mitochondrial uncoupling protein 3 OS=Bos taurus GN=UCP3 PE=2 SV=1 346 522 3.0E-11
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 338 519 3.0E-11
sp|A3LVX1|TPC1_PICST Mitochondrial thiamine pyrophosphate carrier 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TPC1 PE=3 SV=2 439 622 3.0E-11
sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 331 621 3.0E-11
sp|Q2UCW8|TPC1_ASPOR Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tpc1 PE=3 SV=1 342 517 4.0E-11
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 337 523 4.0E-11
sp|Q5PQ27|S2542_XENLA Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus laevis GN=slc25a42 PE=2 SV=1 332 517 4.0E-11
sp|Q8WUT9|S2543_HUMAN Solute carrier family 25 member 43 OS=Homo sapiens GN=SLC25A43 PE=2 SV=2 346 522 4.0E-11
sp|P23641|MPCP_YEAST Mitochondrial phosphate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIR1 PE=1 SV=1 347 625 4.0E-11
sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate transporter/carrier OS=Mus musculus GN=Slc25a32 PE=1 SV=1 337 524 5.0E-11
sp|Q6PIV7|S2534_HUMAN Solute carrier family 25 member 34 OS=Homo sapiens GN=SLC25A34 PE=2 SV=1 342 607 5.0E-11
sp|Q54S10|MCFU_DICDI Mitochondrial substrate carrier family protein U OS=Dictyostelium discoideum GN=mcfU PE=3 SV=1 335 425 6.0E-11
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 435 619 6.0E-11
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 342 522 6.0E-11
sp|Q1DRJ3|S2538_COCIM Solute carrier family 25 member 38 homolog OS=Coccidioides immitis (strain RS) GN=CIMG_07070 PE=3 SV=1 340 618 6.0E-11
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 343 611 6.0E-11
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 344 616 6.0E-11
sp|Q54B67|MCFZ_DICDI Mitochondrial substrate carrier family protein Z OS=Dictyostelium discoideum GN=mcfZ PE=2 SV=1 280 512 7.0E-11
sp|Q05AQ3|S2542_XENTR Mitochondrial coenzyme A transporter SLC25A42 OS=Xenopus tropicalis GN=slc25a42 PE=2 SV=1 332 517 7.0E-11
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 341 621 7.0E-11
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 343 471 7.0E-11
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 342 522 7.0E-11
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 320 522 8.0E-11
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 438 610 9.0E-11
sp|A5DX39|TPC1_LODEL Mitochondrial thiamine pyrophosphate carrier 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TPC1 PE=3 SV=1 346 620 9.0E-11
sp|A7ER02|TPC1_SCLS1 Mitochondrial thiamine pyrophosphate carrier 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tpc1 PE=3 SV=1 342 522 1.0E-10
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 313 522 1.0E-10
sp|Q5SVS4|KMCP1_HUMAN Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=1 SV=1 455 631 1.0E-10
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 455 631 1.0E-10
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 455 631 1.0E-10
sp|Q0CEN9|TPC1_ASPTN Mitochondrial thiamine pyrophosphate carrier 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tpc1 PE=3 SV=1 441 645 1.0E-10
sp|Q6GQ22|KMCP1_XENLA Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1 455 631 1.0E-10
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 453 622 1.0E-10
sp|P55916|UCP3_HUMAN Mitochondrial uncoupling protein 3 OS=Homo sapiens GN=UCP3 PE=1 SV=1 340 522 1.0E-10
sp|P12234|MPCP_BOVIN Phosphate carrier protein, mitochondrial OS=Bos taurus GN=SLC25A3 PE=1 SV=1 359 602 1.0E-10
sp|Q9LV81|BRTL3_ARATH Probable mitochondrial adenine nucleotide transporter BTL3 OS=Arabidopsis thaliana GN=At5g64970 PE=2 SV=1 336 628 1.0E-10
sp|Q3KQZ1|S2535_HUMAN Solute carrier family 25 member 35 OS=Homo sapiens GN=SLC25A35 PE=2 SV=1 342 621 1.0E-10
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 434 619 2.0E-10
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 439 648 2.0E-10
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 440 622 2.0E-10
sp|Q5PQM9|KMCP1_RAT Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1 342 522 2.0E-10
sp|Q5XGI1|KMCP1_XENTR Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1 455 631 2.0E-10
sp|O81845|PUMP1_ARATH Mitochondrial uncoupling protein 1 OS=Arabidopsis thaliana GN=PUMP1 PE=1 SV=1 453 626 2.0E-10
sp|P18238|ADT3_YEAST ADP,ATP carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAC3 PE=1 SV=1 342 527 2.0E-10
sp|P18239|ADT2_YEAST ADP,ATP carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET9 PE=1 SV=2 342 527 2.0E-10
sp|Q9P6N6|S2538_SCHPO Solute carrier family 25 member 38 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC823.10c PE=3 SV=1 440 669 2.0E-10
sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus GN=SLC25A11 PE=1 SV=3 444 616 2.0E-10
sp|Q74Z23|S2538_ASHGO Solute carrier family 25 member 38 homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGR383W PE=3 SV=1 342 622 2.0E-10
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 344 526 2.0E-10
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 343 514 3.0E-10
sp|Q06143|DIC1_YEAST Mitochondrial dicarboxylate transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIC1 PE=1 SV=1 436 622 3.0E-10
sp|P38988|GGC1_YEAST Mitochondrial GTP/GDP carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GGC1 PE=1 SV=1 428 623 3.0E-10
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 439 616 3.0E-10
sp|Q96U08|S2538_NEUCR Solute carrier family 25 member 38 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7F18.090 PE=3 SV=1 338 618 3.0E-10
sp|O14281|YETC_SCHPO Uncharacterized mitochondrial carrier C8C9.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8C9.12c PE=3 SV=1 433 648 4.0E-10
sp|Q75A82|ANT1_ASHGO Peroxisomal adenine nucleotide transporter 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ANT1 PE=3 SV=1 342 598 4.0E-10
sp|Q9P3T7|ODC_SCHPO Probable mitochondrial 2-oxodicarboxylate carrier OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.09 PE=3 SV=1 329 520 5.0E-10
sp|Q6CNY8|S2538_KLULA Solute carrier family 25 member 38 homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0E08911g PE=3 SV=1 440 623 5.0E-10
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 433 621 5.0E-10
sp|Q5R7W2|MPCP_PONAB Phosphate carrier protein, mitochondrial OS=Pongo abelii GN=SLC25A3 PE=2 SV=1 357 602 5.0E-10
sp|Q9CR62|M2OM_MOUSE Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus GN=Slc25a11 PE=1 SV=3 444 616 6.0E-10
sp|Q8BVN7|S2541_MOUSE Solute carrier family 25 member 41 OS=Mus musculus GN=Slc25a41 PE=2 SV=1 433 687 6.0E-10
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 346 522 7.0E-10
sp|Q8HXE3|KMCP1_MACFA Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1 327 522 7.0E-10
sp|P0C546|S2542_RAT Mitochondrial coenzyme A transporter SLC25A42 OS=Rattus norvegicus GN=Slc25a42 PE=2 SV=1 307 622 7.0E-10
sp|Q01888|GDC_BOVIN Graves disease carrier protein OS=Bos taurus GN=SLC25A16 PE=2 SV=1 346 522 8.0E-10
sp|Q5ZKP7|S2536_CHICK Solute carrier family 25 member 36 OS=Gallus gallus GN=SLC25A36 PE=2 SV=1 342 517 8.0E-10
sp|Q02978|M2OM_HUMAN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens GN=SLC25A11 PE=1 SV=3 444 616 8.0E-10
sp|Q0UUH1|TPC1_PHANO Mitochondrial thiamine pyrophosphate carrier 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TPC1 PE=3 SV=3 441 631 8.0E-10
sp|Q58DS3|S2535_BOVIN Solute carrier family 25 member 35 OS=Bos taurus GN=SLC25A35 PE=2 SV=1 445 567 8.0E-10
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 440 687 9.0E-10
sp|P16260|GDC_HUMAN Graves disease carrier protein OS=Homo sapiens GN=SLC25A16 PE=1 SV=3 346 522 9.0E-10
sp|Q6P316|S2540_XENTR Solute carrier family 25 member 40 OS=Xenopus tropicalis GN=slc25a40 PE=2 SV=1 439 619 1.0E-09
sp|Q95J75|MFTC_MACFA Mitochondrial folate transporter/carrier OS=Macaca fascicularis GN=SLC25A32 PE=2 SV=1 337 524 1.0E-09
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 338 519 1.0E-09
sp|Q5XIF9|S2534_RAT Solute carrier family 25 member 34 OS=Rattus norvegicus GN=Slc25a34 PE=2 SV=2 321 607 1.0E-09
sp|Q00325|MPCP_HUMAN Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2 359 602 1.0E-09
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 356 517 1.0E-09
sp|Q93XM7|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carrier-like protein OS=Arabidopsis thaliana GN=BOU PE=2 SV=1 337 526 2.0E-09
sp|P79110|TXTP_BOVIN Tricarboxylate transport protein, mitochondrial OS=Bos taurus GN=SLC25A1 PE=2 SV=1 334 424 2.0E-09
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 442 618 2.0E-09
sp|Q12251|YP011_YEAST Uncharacterized mitochondrial carrier YPR011C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR011C PE=1 SV=1 337 517 2.0E-09
sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate transporter/carrier OS=Homo sapiens GN=SLC25A32 PE=1 SV=2 337 524 2.0E-09
sp|A6RF73|TPC1_AJECN Mitochondrial thiamine pyrophosphate carrier 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TPC1 PE=3 SV=1 342 520 2.0E-09
sp|P40464|FLX1_YEAST Mitochondrial FAD carrier protein FLX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLX1 PE=3 SV=1 325 522 2.0E-09
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 427 565 2.0E-09
sp|P49382|ADT_KLULA ADP,ATP carrier protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAC PE=3 SV=1 356 528 2.0E-09
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 349 531 2.0E-09
sp|Q0II44|S2541_BOVIN Solute carrier family 25 member 41 OS=Bos taurus GN=SLC25A41 PE=2 SV=1 341 579 2.0E-09
sp|A2A3V2|S2543_MOUSE Solute carrier family 25 member 43 OS=Mus musculus GN=Slc25a43 PE=2 SV=1 439 652 2.0E-09
sp|Q6FR88|S2538_CANGA Solute carrier family 25 member 38 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0H10538g PE=3 SV=1 337 618 2.0E-09
sp|Q2H608|S2538_CHAGB Solute carrier family 25 member 38 homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05907 PE=3 SV=1 338 618 2.0E-09
sp|Q8C0K5|GDC_MOUSE Graves disease carrier protein homolog OS=Mus musculus GN=Slc25a16 PE=1 SV=1 346 522 3.0E-09
sp|Q54QN2|MCFM_DICDI Mitochondrial substrate carrier family protein M OS=Dictyostelium discoideum GN=mcfM PE=3 SV=1 336 428 3.0E-09
sp|Q59Q36|TPC1_CANAL Mitochondrial thiamine pyrophosphate carrier 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPC1 PE=3 SV=1 340 616 3.0E-09
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 441 619 3.0E-09
sp|A6ZV78|TPC1_YEAS7 Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=TPC1 PE=3 SV=1 346 616 3.0E-09
sp|Q6BH02|S2538_DEBHA Solute carrier family 25 member 38 homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G22418g PE=3 SV=1 342 618 3.0E-09
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 441 619 3.0E-09
sp|P53257|TPC1_YEAST Mitochondrial thiamine pyrophosphate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPC1 PE=1 SV=1 346 616 3.0E-09
sp|A4QNX2|S247B_DANRE Solute carrier family 25 member 47-B OS=Danio rerio GN=slc25a47b PE=2 SV=1 343 522 4.0E-09
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 439 635 4.0E-09
sp|Q3V132|ADT4_MOUSE ADP/ATP translocase 4 OS=Mus musculus GN=Slc25a31 PE=1 SV=1 342 529 4.0E-09
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 331 517 4.0E-09
sp|Q9HC21|TPC_HUMAN Mitochondrial thiamine pyrophosphate carrier OS=Homo sapiens GN=SLC25A19 PE=1 SV=1 336 517 5.0E-09
sp|A7TIQ0|S2538_VANPO Solute carrier family 25 member 38 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1043p32 PE=3 SV=1 440 658 5.0E-09
sp|Q6FTN2|DIC1_CANGA Mitochondrial dicarboxylate transporter OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIC1 PE=3 SV=1 341 621 5.0E-09
sp|Q9M2Z8|MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana GN=MPT2 PE=2 SV=1 357 631 5.0E-09
sp|Q99297|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC2 PE=1 SV=1 346 520 6.0E-09
sp|Q5NVC1|TPC_PONAB Mitochondrial thiamine pyrophosphate carrier OS=Pongo abelii GN=SLC25A19 PE=2 SV=1 336 505 6.0E-09
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 322 522 6.0E-09
sp|Q54FU9|MCFW_DICDI Mitochondrial substrate carrier family protein W OS=Dictyostelium discoideum GN=mcfW PE=3 SV=1 277 522 7.0E-09
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 455 604 8.0E-09
sp|A2ADF7|S2534_MOUSE Solute carrier family 25 member 34 OS=Mus musculus GN=Slc25a34 PE=1 SV=1 342 607 8.0E-09
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 441 625 9.0E-09
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 434 625 1.0E-08
sp|Q920G8|MFRN1_MOUSE Mitoferrin-1 OS=Mus musculus GN=Slc25a37 PE=1 SV=1 440 619 1.0E-08
sp|P04575|UCP1_MESAU Mitochondrial brown fat uncoupling protein 1 OS=Mesocricetus auratus GN=UCP1 PE=1 SV=3 438 622 1.0E-08
sp|Q9ER18|UCP1_PHOSU Mitochondrial brown fat uncoupling protein 1 OS=Phodopus sungorus GN=UCP1 PE=2 SV=1 438 622 1.0E-08
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 440 623 1.0E-08
sp|Q09188|ADT_SCHPO ADP,ATP carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=anc1 PE=2 SV=1 356 527 1.0E-08
sp|Q3SZK0|S2534_BOVIN Solute carrier family 25 member 34 OS=Bos taurus GN=SLC25A34 PE=2 SV=1 342 607 1.0E-08
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 340 620 1.0E-08
sp|A7F9Y3|S2538_SCLS1 Solute carrier family 25 member 38 homolog OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14414 PE=3 SV=1 335 618 1.0E-08
sp|O94370|YG04_SCHPO Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 346 616 1.0E-08
sp|Q9QXX4|CMC2_MOUSE Calcium-binding mitochondrial carrier protein Aralar2 OS=Mus musculus GN=Slc25a13 PE=1 SV=1 328 435 2.0E-08
sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFC1 PE=1 SV=2 345 428 2.0E-08
sp|Q76P23|PM34_DICDI Mitochondrial substrate carrier family protein Q OS=Dictyostelium discoideum GN=mcfQ PE=2 SV=1 427 621 2.0E-08
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 443 619 2.0E-08
sp|P32331|YMC1_YEAST Carrier protein YMC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMC1 PE=3 SV=2 440 618 2.0E-08
sp|Q8SQH5|ADT2_BOVIN ADP/ATP translocase 2 OS=Bos taurus GN=SLC25A5 PE=2 SV=3 342 522 2.0E-08
sp|Q29RM1|TPC_BOVIN Mitochondrial thiamine pyrophosphate carrier OS=Bos taurus GN=SLC25A19 PE=2 SV=1 442 640 2.0E-08
sp|Q9GMZ1|UCP1_CANLF Mitochondrial brown fat uncoupling protein 1 OS=Canis lupus familiaris GN=UCP1 PE=2 SV=1 346 525 2.0E-08
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 443 622 2.0E-08
sp|Q9UBX3|DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 345 619 2.0E-08
sp|Q96U08|S2538_NEUCR Solute carrier family 25 member 38 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B7F18.090 PE=3 SV=1 442 625 2.0E-08
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 441 621 2.0E-08
sp|Q8R0Y8|S2542_MOUSE Mitochondrial coenzyme A transporter SLC25A42 OS=Mus musculus GN=Slc25a42 PE=1 SV=1 307 622 2.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 441 616 2.0E-08
sp|Q8VZS0|PNC2_ARATH Peroxisomal adenine nucleotide carrier 2 OS=Arabidopsis thaliana GN=PNC2 PE=1 SV=1 337 604 2.0E-08
sp|Q5H9E4|S2553_HUMAN Solute carrier family 25 member 53 OS=Homo sapiens GN=SLC25A53 PE=2 SV=1 328 619 2.0E-08
sp|Q86AV5|MCFX_DICDI Mitochondrial substrate carrier family protein X OS=Dictyostelium discoideum GN=mcfX PE=3 SV=1 343 430 3.0E-08
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 334 424 3.0E-08
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 336 505 3.0E-08
sp|Q41629|ADT1_WHEAT ADP,ATP carrier protein 1, mitochondrial OS=Triticum aestivum GN=ANT-G1 PE=3 SV=1 355 527 3.0E-08
sp|O13805|YE08_SCHPO Uncharacterized mitochondrial carrier C17H9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.08 PE=3 SV=1 343 521 3.0E-08
sp|Q75EP3|TPC1_ASHGO Mitochondrial thiamine pyrophosphate carrier 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TPC1 PE=3 SV=1 334 616 3.0E-08
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 334 424 4.0E-08
sp|P12235|ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 342 524 4.0E-08
sp|P51881|ADT2_MOUSE ADP/ATP translocase 2 OS=Mus musculus GN=Slc25a5 PE=1 SV=3 342 522 4.0E-08
sp|P97700|M2OM_RAT Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus GN=Slc25a11 PE=1 SV=3 444 616 4.0E-08
sp|O61703|MPCP_CHOFU Phosphate carrier protein, mitochondrial OS=Choristoneura fumiferana PE=2 SV=1 339 625 4.0E-08
sp|Q84UC7|BAC1_ARATH Mitochondrial arginine transporter BAC1 OS=Arabidopsis thaliana GN=BAC1 PE=1 SV=1 426 619 5.0E-08
sp|Q6P036|S2533_DANRE Solute carrier family 25 member 33 OS=Danio rerio GN=slc25a33 PE=2 SV=1 440 596 5.0E-08
sp|Q9NYZ2|MFRN1_HUMAN Mitoferrin-1 OS=Homo sapiens GN=SLC25A37 PE=2 SV=2 440 619 5.0E-08
sp|Q66H23|MFRN1_RAT Mitoferrin-1 OS=Rattus norvegicus GN=Slc25a37 PE=2 SV=1 440 619 5.0E-08
sp|P31691|ADT_ORYSJ ADP,ATP carrier protein, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0718900 PE=2 SV=1 355 527 5.0E-08
sp|Q5AVW1|TPC1_EMENI Mitochondrial thiamine pyrophosphate carrier 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpc1 PE=3 SV=1 342 517 5.0E-08
sp|Q8K404|UCP1_DICGR Mitochondrial brown fat uncoupling protein 1 OS=Dicrostonyx groenlandicus GN=UCP1 PE=2 SV=1 443 622 5.0E-08
sp|Q6FR88|S2538_CANGA Solute carrier family 25 member 38 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0H10538g PE=3 SV=1 438 623 5.0E-08
sp|Q8JZU2|TXTP_MOUSE Tricarboxylate transport protein, mitochondrial OS=Mus musculus GN=Slc25a1 PE=1 SV=1 438 603 6.0E-08
sp|P25874|UCP1_HUMAN Mitochondrial brown fat uncoupling protein 1 OS=Homo sapiens GN=UCP1 PE=2 SV=3 346 524 6.0E-08
sp|Q9DAM5|TPC_MOUSE Mitochondrial thiamine pyrophosphate carrier OS=Mus musculus GN=Slc25a19 PE=1 SV=1 342 505 6.0E-08
sp|Q05962|ADT1_RAT ADP/ATP translocase 1 OS=Rattus norvegicus GN=Slc25a4 PE=1 SV=3 342 524 6.0E-08
sp|P48962|ADT1_MOUSE ADP/ATP translocase 1 OS=Mus musculus GN=Slc25a4 PE=1 SV=4 342 524 6.0E-08
sp|Q09073|ADT2_RAT ADP/ATP translocase 2 OS=Rattus norvegicus GN=Slc25a5 PE=1 SV=3 342 522 6.0E-08
sp|Q6C6I3|S2538_YARLI Solute carrier family 25 member 38 homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E09284g PE=3 SV=1 439 623 6.0E-08
sp|Q551X6|MCFV_DICDI Mitochondrial substrate carrier family protein V OS=Dictyostelium discoideum GN=mcfV PE=3 SV=1 333 425 6.0E-08
sp|Q9XI74|PUMP3_ARATH Mitochondrial uncoupling protein 3 OS=Arabidopsis thaliana GN=PUMP3 PE=2 SV=1 344 520 7.0E-08
sp|Q9QZD8|DIC_MOUSE Mitochondrial dicarboxylate carrier OS=Mus musculus GN=Slc25a10 PE=1 SV=2 333 596 8.0E-08
sp|A3M019|S2538_PICST Solute carrier family 25 member 38 homolog OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_91291 PE=3 SV=2 335 618 8.0E-08
sp|A6S8E0|S2538_BOTFB Solute carrier family 25 member 38 homolog OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_09631 PE=3 SV=1 335 618 9.0E-08
sp|Q5RBC8|CMC1_PONAB Calcium-binding mitochondrial carrier protein Aralar1 OS=Pongo abelii GN=SLC25A12 PE=2 SV=1 346 522 1.0E-07
sp|O75746|CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 346 522 1.0E-07
sp|Q9M038|SFC1_ARATH Mitochondrial succinate-fumarate transporter 1 OS=Arabidopsis thaliana GN=SFC1 PE=2 SV=1 334 428 1.0E-07
sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial OS=Rattus norvegicus GN=Slc25a1 PE=1 SV=1 438 603 1.0E-07
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 334 424 1.0E-07
sp|Q6J329|S2547_RAT Solute carrier family 25 member 47 OS=Rattus norvegicus GN=Slc25a47 PE=2 SV=1 440 619 1.0E-07
sp|Q6C107|TPC1_YARLI Mitochondrial thiamine pyrophosphate carrier 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TPC1 PE=3 SV=1 434 615 1.0E-07
sp|P05141|ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 342 522 1.0E-07
sp|Q000K2|ADT2_TACAC ADP/ATP translocase 2 OS=Tachyglossus aculeatus aculeatus GN=SLC25A5 PE=2 SV=1 342 522 1.0E-07
sp|Q5R5A1|ADT2_PONAB ADP/ATP translocase 2 OS=Pongo abelii GN=SLC25A5 PE=2 SV=3 342 522 1.0E-07
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 346 521 1.0E-07
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 335 522 1.0E-07
sp|Q9SUV1|BRT1_ARATH Adenine nucleotide transporter BT1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=BT1 PE=1 SV=1 441 619 2.0E-07
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 439 619 2.0E-07
sp|Q1LZB3|S2533_BOVIN Solute carrier family 25 member 33 OS=Bos taurus GN=SLC25A33 PE=2 SV=1 440 633 2.0E-07
sp|Q96CQ1|S2536_HUMAN Solute carrier family 25 member 36 OS=Homo sapiens GN=SLC25A36 PE=1 SV=1 342 517 2.0E-07
sp|Q2YDD9|ADT4_BOVIN ADP/ATP translocase 4 OS=Bos taurus GN=SLC25A31 PE=2 SV=1 437 659 2.0E-07
sp|P12242|UCP1_MOUSE Mitochondrial brown fat uncoupling protein 1 OS=Mus musculus GN=Ucp1 PE=1 SV=2 443 622 2.0E-07
sp|Q6PH61|S2534_DANRE Solute carrier family 25 member 34 OS=Danio rerio GN=slc25a34 PE=2 SV=1 337 425 2.0E-07
sp|A5D9W9|S2538_PICGU Solute carrier family 25 member 38 homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_00074 PE=3 SV=2 440 620 2.0E-07
sp|Q9C5M0|DTC_ARATH Mitochondrial dicarboxylate/tricarboxylate transporter DTC OS=Arabidopsis thaliana GN=DTC PE=1 SV=1 442 652 2.0E-07
sp|O13660|YBC9_SCHPO Uncharacterized mitochondrial carrier C27B12.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi069 PE=3 SV=1 440 619 2.0E-07
sp|Q9MA90|PNC1_ARATH Peroxisomal adenine nucleotide carrier 1 OS=Arabidopsis thaliana GN=PNC1 PE=1 SV=1 333 604 2.0E-07
sp|P53007|TXTP_HUMAN Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2 438 603 3.0E-07
sp|O04619|ADNT1_ARATH Mitochondrial adenine nucleotide transporter ADNT1 OS=Arabidopsis thaliana GN=ADNT1 PE=2 SV=1 334 425 3.0E-07
sp|Q3TZX3|S2533_MOUSE Solute carrier family 25 member 33 OS=Mus musculus GN=Slc25a33 PE=2 SV=1 440 687 3.0E-07
sp|Q287T7|MFRN1_DANRE Mitoferrin-1 OS=Danio rerio GN=slc25a37 PE=1 SV=1 438 619 3.0E-07
sp|P04633|UCP1_RAT Mitochondrial brown fat uncoupling protein 1 OS=Rattus norvegicus GN=Ucp1 PE=1 SV=2 443 622 3.0E-07
sp|Q54QI8|MCFR_DICDI Mitochondrial substrate carrier family protein R OS=Dictyostelium discoideum GN=mcfR PE=3 SV=1 329 520 3.0E-07
sp|O70579|PM34_MOUSE Peroxisomal membrane protein PMP34 OS=Mus musculus GN=Slc25a17 PE=1 SV=1 327 525 3.0E-07
sp|Q552L9|S2540_DICDI Mitochondrial substrate carrier family protein H OS=Dictyostelium discoideum GN=mcfH PE=3 SV=1 441 620 4.0E-07
sp|Q8RWA5|NDT2_ARATH Nicotinamide adenine dinucleotide transporter 2, mitochondrial OS=Arabidopsis thaliana GN=NDT2 PE=1 SV=1 344 428 4.0E-07
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 315 428 4.0E-07
sp|O94502|YBT5_SCHPO Uncharacterized mitochondrial carrier C12D12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12D12.05c PE=3 SV=2 442 619 4.0E-07
sp|O46373|ADT1_RABIT ADP/ATP translocase 1 OS=Oryctolagus cuniculus GN=SLC25A4 PE=2 SV=3 342 524 4.0E-07
sp|P38702|LEU5_YEAST Mitochondrial carrier protein LEU5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEU5 PE=3 SV=1 503 632 4.0E-07
sp|P14271|UCP1_RABIT Mitochondrial brown fat uncoupling protein 1 OS=Oryctolagus cuniculus GN=UCP1 PE=2 SV=1 430 622 4.0E-07
sp|Q86VD7|S2542_HUMAN Mitochondrial coenzyme A transporter SLC25A42 OS=Homo sapiens GN=SLC25A42 PE=2 SV=2 313 622 4.0E-07
sp|Q498U3|S2540_RAT Solute carrier family 25 member 40 OS=Rattus norvegicus GN=Slc25a40 PE=2 SV=2 338 428 5.0E-07
sp|Q54EV4|MCFA_DICDI Mitochondrial substrate carrier family protein A OS=Dictyostelium discoideum GN=mcfA PE=3 SV=1 169 422 5.0E-07
sp|Q54VS7|TPC_DICDI Probable mitochondrial thiamine pyrophosphate carrier OS=Dictyostelium discoideum GN=mcfK PE=3 SV=1 440 621 5.0E-07
sp|P02722|ADT1_BOVIN ADP/ATP translocase 1 OS=Bos taurus GN=SLC25A4 PE=1 SV=3 342 524 5.0E-07
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 337 517 5.0E-07
sp|Q0CT66|S2538_ASPTN Solute carrier family 25 member 38 homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_03118 PE=3 SV=1 443 679 5.0E-07
sp|Q03028|ODC1_YEAST Mitochondrial 2-oxodicarboxylate carrier 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ODC1 PE=1 SV=1 530 669 6.0E-07
sp|Q9ZWG1|PUMP2_ARATH Mitochondrial uncoupling protein 2 OS=Arabidopsis thaliana GN=PUMP2 PE=2 SV=1 348 522 6.0E-07
sp|A0PC02|UCP1_OCHDA Mitochondrial brown fat uncoupling protein 1 OS=Ochotona dauurica GN=UCP1 PE=2 SV=1 346 525 6.0E-07
sp|Q9FY68|PUMP6_ARATH Mitochondrial uncoupling protein 6 OS=Arabidopsis thaliana GN=PUMP6 PE=2 SV=1 454 679 7.0E-07
sp|O13844|YFG5_SCHPO Uncharacterized mitochondrial carrier C19G12.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19G12.05 PE=3 SV=1 334 424 9.0E-07
sp|Q09834|YAD8_SCHPO Uncharacterized mitochondrial carrier C4G8.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.08 PE=3 SV=1 344 620 9.0E-07
sp|Q8BH59|CMC1_MOUSE Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus GN=Slc25a12 PE=1 SV=1 346 522 1.0E-06
sp|Q0VCH6|S2540_BOVIN Solute carrier family 25 member 40 OS=Bos taurus GN=SLC25A40 PE=2 SV=1 342 428 1.0E-06
sp|Q7SXW0|S2539_DANRE Solute carrier family 25 member 39 OS=Danio rerio GN=slc25a39 PE=2 SV=1 300 528 1.0E-06
sp|Q9BSK2|S2533_HUMAN Solute carrier family 25 member 33 OS=Homo sapiens GN=SLC25A33 PE=1 SV=1 440 647 1.0E-06
sp|Q8TFH2|YIKC_SCHPO Uncharacterized mitochondrial carrier PB17E12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.12c PE=3 SV=1 334 522 1.0E-06
sp|Q52KK3|S2551_RAT Solute carrier family 25 member 51 OS=Rattus norvegicus GN=Slc25a51 PE=2 SV=1 391 622 1.0E-06
sp|A7TDX5|TPC1_VANPO Mitochondrial thiamine pyrophosphate carrier 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TPC1 PE=3 SV=1 342 622 1.0E-06
sp|Q8BW66|S2548_MOUSE Solute carrier family 25 member 48 OS=Mus musculus GN=Slc25a48 PE=1 SV=2 439 640 2.0E-06
sp|Q8TBP6|S2540_HUMAN Solute carrier family 25 member 40 OS=Homo sapiens GN=SLC25A40 PE=1 SV=1 342 428 2.0E-06
sp|F4HT41|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic OS=Arabidopsis thaliana GN=SAMC2 PE=2 SV=1 439 619 2.0E-06
sp|Q3MHI3|S2548_BOVIN Solute carrier family 25 member 48 OS=Bos taurus GN=SLC25A48 PE=2 SV=1 440 640 2.0E-06
sp|Q944H5|MTM1_ARATH Mitochondrial carrier protein MTM1 OS=Arabidopsis thaliana GN=MTM1 PE=2 SV=1 344 521 2.0E-06
sp|A5DIS9|TPC1_PICGU Mitochondrial thiamine pyrophosphate carrier 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TPC1 PE=3 SV=3 515 602 2.0E-06
sp|O94344|YHMB_SCHPO Uncharacterized mitochondrial carrier C1271.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.11 PE=3 SV=1 344 620 2.0E-06
sp|P34519|TXTP_CAEEL Putative tricarboxylate transport protein, mitochondrial OS=Caenorhabditis elegans GN=K11H3.3 PE=3 SV=1 344 437 3.0E-06
sp|Q4PDL5|S2538_USTMA Solute carrier family 25 member 38 homolog OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_10880 PE=3 SV=2 342 603 3.0E-06
sp|O94370|YG04_SCHPO Uncharacterized mitochondrial carrier C1604.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1604.04 PE=3 SV=2 336 422 3.0E-06
sp|P40614|MPCP_CAEEL Phosphate carrier protein, mitochondrial OS=Caenorhabditis elegans GN=F01G4.6 PE=2 SV=1 357 602 3.0E-06
sp|A8WQT4|MICU1_CAEBR Calcium uptake protein 1 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG01795 PE=3 SV=2 45 262 3.0E-06
sp|Q4V8K4|S2539_RAT Solute carrier family 25 member 39 OS=Rattus norvegicus GN=Slc25a39 PE=2 SV=1 342 428 4.0E-06
sp|Q17QI7|S2539_BOVIN Solute carrier family 25 member 39 OS=Bos taurus GN=SLC25A39 PE=2 SV=2 342 428 4.0E-06
sp|Q41630|ADT2_WHEAT ADP,ATP carrier protein 2, mitochondrial OS=Triticum aestivum GN=ANT-G2 PE=3 SV=1 355 527 4.0E-06
sp|Q9SJY5|PUMP5_ARATH Mitochondrial uncoupling protein 5 OS=Arabidopsis thaliana GN=PUMP5 PE=2 SV=1 359 522 4.0E-06
sp|Q8LB08|ADT4_ARATH ADP,ATP carrier protein ER-ANT1 OS=Arabidopsis thaliana GN=ER-ANT1 PE=2 SV=2 457 622 4.0E-06
sp|P32332|OAC1_YEAST Mitochondrial oxaloacetate transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAC1 PE=1 SV=1 347 419 5.0E-06
sp|Q55BF4|UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 359 527 6.0E-06
sp|Q86HN8|MCFY_DICDI Mitochondrial substrate carrier family protein Y OS=Dictyostelium discoideum GN=mcfY PE=3 SV=1 346 517 6.0E-06
sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PET8 PE=1 SV=1 440 641 6.0E-06
sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier OS=Rattus norvegicus GN=Slc25a21 PE=2 SV=1 334 422 9.0E-06
sp|Q94AG6|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SAMC1 PE=1 SV=1 337 524 9.0E-06
sp|Q5IS35|TPC_MACFA Mitochondrial thiamine pyrophosphate carrier OS=Macaca fascicularis GN=SLC25A19 PE=2 SV=1 335 411 9.0E-06
sp|Q9SB52|PUMP4_ARATH Mitochondrial uncoupling protein 4 OS=Arabidopsis thaliana GN=PUMP4 PE=2 SV=1 346 522 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3728
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1629 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5836
Ophiocordyceps camponoti-floridani Ophcf2|04848
Ophiocordyceps camponoti-rufipedis Ophun1|6103
Ophiocordyceps kimflemingae Ophio5|7370
Ophiocordyceps subramaniannii Hirsu2|7278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1629
MAVKGVVKETLVGAEEPTPQLSAQSKARFMSKAIKDPVTGELYMGRDEFIDAVVPSNEDHHKIKRDQYSILFRVA
DSKGTGRVTIADWGVFENLLLKSDAEYEIAFRLFDVDRTGSVKYDDFRRLYELNKGPDNIPFDWDCEWARLYIGS
KKKRHDLSYPQFAQMLRGLQGERIRQAFQLFDKDGDGYIDPEDFERIILETSRHKLSDHLLANLATLCNISTGSK
ISYAHVRAFQNMIKEMDLVELIVRRAAARSADGKITRAEFINEAARVTRFSFFTPMEADILFHFASLDEPSGRLG
LSDFAKVLDPSWRMAEPAASTLHKETSTKAAFMNKALESTYNFVLGSIAGAFGAFMVYPIDLVKTRLQNQRGAQP
GQRLYKNSIDCFQKVIRNEGIRGLYSGVLPQLVGVAPEKAIKLTVNDLVRGHFTTKTGDIWWGHEVVAGASAGAC
QVIFTNPLEIVKIRLQVQGEVVKTAESAPKRSAMWIVRNLGLMGLYKGASACLLRDVPFSAIYFPTYSHLKRDVF
GETSSKKLGVLQLLTAGAIAGMPAAYLTTPCDVIKTRLQVEARKGEASYTGLRDAAKKIWHEEGFRAFFKGGPAR
ILRSSPQFGFTLAAYEVLQSVMPMPGAAGKTHGGVGDAMSSLATSAADSSPFARSRNALKIILDLDEDFGKVRMP
NEEGWRTLPRAMGGGGRAA*
Coding >OphauG2|1629
ATGGCGGTCAAAGGGGTAGTCAAGGAGACGCTCGTGGGCGCGGAGGAGCCGACGCCGCAGCTGTCAGCGCAGAGC
AAAGCACGCTTCATGAGCAAGGCCATCAAGGATCCCGTCACGGGCGAGCTGTACATGGGGCGCGACGAGTTCATC
GACGCCGTGGTGCCTAGCAATGAAGACCATCACAAGATCAAGCGCGACCAGTACTCGATTCTCTTCCGCGTTGCC
GATAGCAAAGGCACCGGGCGCGTCACCATTGCAGACTGGGGCGTCTTTGAAAACCTGCTGCTCAAGTCGGACGCC
GAGTACGAGATTGCCTTTCGCCTGTTTGACGTGGACCGCACGGGCAGCGTCAAGTATGACGATTTCCGGCGCCTC
TATGAGCTCAACAAGGGCCCCGACAACATACCCTTTGACTGGGACTGCGAGTGGGCACGCCTGTACATTGGTAGC
AAAAAGAAGCGGCACGACCTAAGCTACCCTCAGTTTGCACAGATGCTGCGAGGTCTGCAGGGCGAGCGCATCCGC
CAGGCCTTTCAGCTCTTCGACAAGGACGGGGACGGCTACATTGACCCCGAGGACTTTGAGCGCATCATCCTGGAG
ACGTCGCGACACAAGCTGTCGGACCATCTGCTTGCCAATCTGGCGACGCTCTGCAACATCTCAACCGGCAGCAAG
ATCTCGTATGCCCATGTGCGGGCCTTTCAAAACATGATCAAGGAAATGGATCTGGTGGAGCTGATTGTGCGGCGG
GCGGCGGCACGGAGCGCCGATGGCAAGATTACGCGAGCCGAGTTTATCAATGAGGCAGCGCGCGTCACGCGCTTT
TCCTTTTTTACGCCCATGGAGGCGGACATTCTCTTCCACTTTGCCAGCCTTGACGAGCCGTCGGGGCGGCTGGGC
CTCAGCGACTTTGCCAAGGTGCTTGACCCGTCGTGGCGCATGGCGGAGCCGGCAGCGTCAACATTACACAAGGAG
ACATCAACCAAGGCGGCCTTTATGAATAAGGCGCTTGAGTCGACATACAACTTTGTGCTAGGCAGCATAGCTGGA
GCCTTTGGGGCCTTTATGGTCTACCCCATCGACTTGGTCAAGACACGGCTGCAAAACCAGCGAGGAGCGCAACCC
GGGCAGCGGCTGTACAAGAACTCGATTGACTGCTTCCAAAAAGTAATTCGCAACGAGGGCATTCGCGGGCTGTAC
TCGGGCGTGCTGCCGCAGCTGGTGGGGGTGGCACCGGAAAAGGCCATCAAGCTGACAGTAAACGACCTGGTGCGC
GGCCACTTTACAACCAAGACGGGAGACATTTGGTGGGGGCACGAAGTGGTTGCAGGCGCGAGCGCCGGAGCGTGC
CAAGTTATCTTTACGAACCCGCTCGAGATTGTCAAGATCCGGCTACAGGTGCAGGGCGAGGTGGTCAAGACGGCG
GAAAGCGCGCCTAAACGATCGGCCATGTGGATTGTGCGCAACCTGGGACTGATGGGGCTGTACAAGGGGGCGTCG
GCATGCCTGTTACGCGATGTGCCCTTTTCAGCCATCTACTTCCCCACATACAGCCATCTGAAGCGCGACGTGTTT
GGCGAGACGAGCAGCAAGAAACTGGGAGTGCTGCAGCTGTTGACTGCAGGTGCCATTGCAGGCATGCCGGCGGCT
TATCTGACGACGCCATGCGACGTCATCAAGACGCGGCTGCAGGTGGAGGCGCGCAAGGGCGAGGCCAGCTACACG
GGGCTGCGAGATGCGGCCAAGAAGATATGGCACGAAGAGGGCTTTCGAGCCTTTTTCAAGGGCGGCCCGGCTCGC
ATCCTGCGGTCGTCGCCGCAGTTTGGCTTTACGCTGGCGGCATACGAGGTGCTGCAGTCGGTCATGCCCATGCCG
GGCGCAGCGGGCAAGACGCATGGCGGCGTGGGCGATGCCATGAGCAGCCTGGCCACCAGCGCGGCCGACTCGTCG
CCGTTTGCACGGAGCCGCAATGCGCTCAAGATTATCCTTGATCTGGACGAGGACTTTGGCAAGGTGCGCATGCCC
AACGAGGAGGGCTGGCGGACGCTGCCGAGGGCCATGGGGGGCGGCGGTAGAGCAGCTTAG
Transcript >OphauG2|1629
ATGGCGGTCAAAGGGGTAGTCAAGGAGACGCTCGTGGGCGCGGAGGAGCCGACGCCGCAGCTGTCAGCGCAGAGC
AAAGCACGCTTCATGAGCAAGGCCATCAAGGATCCCGTCACGGGCGAGCTGTACATGGGGCGCGACGAGTTCATC
GACGCCGTGGTGCCTAGCAATGAAGACCATCACAAGATCAAGCGCGACCAGTACTCGATTCTCTTCCGCGTTGCC
GATAGCAAAGGCACCGGGCGCGTCACCATTGCAGACTGGGGCGTCTTTGAAAACCTGCTGCTCAAGTCGGACGCC
GAGTACGAGATTGCCTTTCGCCTGTTTGACGTGGACCGCACGGGCAGCGTCAAGTATGACGATTTCCGGCGCCTC
TATGAGCTCAACAAGGGCCCCGACAACATACCCTTTGACTGGGACTGCGAGTGGGCACGCCTGTACATTGGTAGC
AAAAAGAAGCGGCACGACCTAAGCTACCCTCAGTTTGCACAGATGCTGCGAGGTCTGCAGGGCGAGCGCATCCGC
CAGGCCTTTCAGCTCTTCGACAAGGACGGGGACGGCTACATTGACCCCGAGGACTTTGAGCGCATCATCCTGGAG
ACGTCGCGACACAAGCTGTCGGACCATCTGCTTGCCAATCTGGCGACGCTCTGCAACATCTCAACCGGCAGCAAG
ATCTCGTATGCCCATGTGCGGGCCTTTCAAAACATGATCAAGGAAATGGATCTGGTGGAGCTGATTGTGCGGCGG
GCGGCGGCACGGAGCGCCGATGGCAAGATTACGCGAGCCGAGTTTATCAATGAGGCAGCGCGCGTCACGCGCTTT
TCCTTTTTTACGCCCATGGAGGCGGACATTCTCTTCCACTTTGCCAGCCTTGACGAGCCGTCGGGGCGGCTGGGC
CTCAGCGACTTTGCCAAGGTGCTTGACCCGTCGTGGCGCATGGCGGAGCCGGCAGCGTCAACATTACACAAGGAG
ACATCAACCAAGGCGGCCTTTATGAATAAGGCGCTTGAGTCGACATACAACTTTGTGCTAGGCAGCATAGCTGGA
GCCTTTGGGGCCTTTATGGTCTACCCCATCGACTTGGTCAAGACACGGCTGCAAAACCAGCGAGGAGCGCAACCC
GGGCAGCGGCTGTACAAGAACTCGATTGACTGCTTCCAAAAAGTAATTCGCAACGAGGGCATTCGCGGGCTGTAC
TCGGGCGTGCTGCCGCAGCTGGTGGGGGTGGCACCGGAAAAGGCCATCAAGCTGACAGTAAACGACCTGGTGCGC
GGCCACTTTACAACCAAGACGGGAGACATTTGGTGGGGGCACGAAGTGGTTGCAGGCGCGAGCGCCGGAGCGTGC
CAAGTTATCTTTACGAACCCGCTCGAGATTGTCAAGATCCGGCTACAGGTGCAGGGCGAGGTGGTCAAGACGGCG
GAAAGCGCGCCTAAACGATCGGCCATGTGGATTGTGCGCAACCTGGGACTGATGGGGCTGTACAAGGGGGCGTCG
GCATGCCTGTTACGCGATGTGCCCTTTTCAGCCATCTACTTCCCCACATACAGCCATCTGAAGCGCGACGTGTTT
GGCGAGACGAGCAGCAAGAAACTGGGAGTGCTGCAGCTGTTGACTGCAGGTGCCATTGCAGGCATGCCGGCGGCT
TATCTGACGACGCCATGCGACGTCATCAAGACGCGGCTGCAGGTGGAGGCGCGCAAGGGCGAGGCCAGCTACACG
GGGCTGCGAGATGCGGCCAAGAAGATATGGCACGAAGAGGGCTTTCGAGCCTTTTTCAAGGGCGGCCCGGCTCGC
ATCCTGCGGTCGTCGCCGCAGTTTGGCTTTACGCTGGCGGCATACGAGGTGCTGCAGTCGGTCATGCCCATGCCG
GGCGCAGCGGGCAAGACGCATGGCGGCGTGGGCGATGCCATGAGCAGCCTGGCCACCAGCGCGGCCGACTCGTCG
CCGTTTGCACGGAGCCGCAATGCGCTCAAGATTATCCTTGATCTGGACGAGGACTTTGGCAAGGTGCGCATGCCC
AACGAGGAGGGCTGGCGGACGCTGCCGAGGGCCATGGGGGGCGGCGGTAGAGCAGCTTAG
Gene >OphauG2|1629
ATGGCGGTCAAAGGGGTAGTCAAGGAGACGCTCGTGGGCGCGGAGGAGCCGACGCCGCAGCTGTCAGCGCAGAGC
AAAGCACGCTTCATGAGCAAGGCCATCAAGGATCCCGTCACGGGCGAGCTGTACATGGGGCGCGACGAGTTCATC
GACGCCGTGGTGCCTAGCAATGAAGACCATGTGAGTCGGGTTGCAGCTTGTCAAGCACCAAGCGAGGAGATGCTG
ACGCGAGCATCACGCAATACAGCACAAGATCAAGCGCGACCAGTACTCGATTCTCTTCCGCGTTGCCGATAGCAA
AGGCACCGGGCGCGTCACCATTGCAGACTGGGGCGTCTTTGAAAACCTGCTGCTCAAGTCGGACGCCGAGTACGA
GATTGCCTTTCGCCTGTTTGACGTGGACCGCACGGGCAGCGTCAAGTATGACGATTTCCGGCGCCTCTATGAGCT
CAACAAGGGCCCCGACAACATACCCTTTGACTGGGACTGCGAGTGGGCACGCCTGTACATTGGTAGCAAAAAGAA
GCGGCACGACCTAAGCTACCCTCAGTTTGCACAGATGCTGCGAGGTCTGCAGGGCGAGCGCATCCGCCAGGCCTT
TCAGCTCTTCGACAAGGACGGGGACGGCTACATTGACCCCGAGGACTTTGAGCGCATCATCCTGGAGACGTCGCG
ACACAAGCTGTCGGACCATCTGCTTGCCAATCTGGCGACGCTCTGCAACATCTCAACCGGCAGCAAGATCTCGTA
TGCCCATGTGCGGGCCTTTCAAAACATGATCAAGGAAATGGATCTGGTGGAGCTGATTGTGCGGCGGGCGGCGGC
ACGGAGCGCCGATGGCAAGATTACGCGAGCCGAGTTTATCAATGAGGCAGCGCGCGTCACGCGCTTTTCCTTTTT
TACGCCCATGGAGGCGGACATTCTCTTCCACTTTGCCAGCCTTGACGAGCCGTCGGGGCGGCTGGGCCTCAGCGA
CTTTGCCAAGGTGCTTGACCCGTCGTGGCGCATGGCGGAGCCGGCAGCGTCAACATTACACAAGGAGACATCAAC
CAAGGCGGCCTTTATGAATAAGGCGCTTGAGTCGACATACAACTTTGTGCTAGGCAGCATAGCTGGAGCCTTTGG
GGCCTTTATGGTCTACCCCATCGACTTGGTCAAGACACGGCTGCAAAACCAGCGAGGAGCGCAACCCGGGCAGCG
GCTGTACAAGAACTCGATTGACTGCTTCCAAAAAGTAATTCGCAACGAGGGCATTCGCGGGCTGTACTCGGGCGT
GCTGCCGCAGCTGGTGGGGGTGGCACCGGAAAAGGCCATCAAGCTGACAGTAAACGACCTGGTGCGCGGCCACTT
TACAACCAAGACGGGAGACATTTGGTGGGGGCACGAAGTGGTTGCAGGCGCGAGCGCCGGAGCGTGCCAAGTTGT
ATGTGTGGTGGCAGAGGAGAGGCTTGGAGAGAAAGTTGCTTACACTGTGGGCTGCTAGATCTTTACGAACCCGCT
CGAGATTGTCAAGATCCGGCTACAGGTGCAGGGCGAGGTGGTCAAGACGGCGGAAAGCGCGCCTAAACGATCGGC
CATGTGGATTGTGCGCAACCTGGGACTGATGGGGCTGTACAAGGGGGCGTCGGCATGCCTGTTACGCGATGTGCC
CTTTTCAGCCATCTACTTCCCCACATACAGCCATCTGAAGCGCGACGTGTTTGGCGAGACGAGCAGCAAGAAACT
GGGAGTGCTGCAGCTGTTGACTGCAGGTGCCATTGCAGGCATGCCGGCGGCTTATCTGACGACGCCATGCGACGT
CATCAAGACGCGGCTGCAGGTGGAGGCGCGCAAGGGCGAGGCCAGCTACACGGGGCTGCGAGATGCGGCCAAGAA
GATATGGCACGAAGAGGGCTTTCGAGCCTTTTTCAAGGGCGGCCCGGCTCGCATCCTGCGGTCGTCGCCGCAGTT
TGGCTTTACGCTGGCGGCATACGAGGTGCTGCAGTCGGTCATGCCCATGCCGGGCGCAGCGGGCAAGACGCATGG
CGGCGTGGGCGATGCCATGAGCAGCCTGGCCACCAGCGCGGCCGACTCGTCGCCGTTTGCACGGAGCCGCAATGC
GCTCAAGATTATCCTTGATCTGGACGAGGACTTTGGCAAGGTGCGCATGCCCAACGAGGAGGGCTGGCGGACGCT
GCCGAGGGCCATGGGGGGCGGCGGTAGAGCAGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail