Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1627
Gene name
LocationContig_150:3938..6811
Strand+
Gene length (bp)2873
Transcript length (bp)2808
Coding sequence length (bp)2808
Protein length (aa) 936

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 9.2E-21 74 212
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 6.2E-06 439 530
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 2.0E-05 648 689
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 4.3E-20 81 214
PF13603 tRNA-synt_1_2 Leucyl-tRNA synthetase, Domain 2 1.1E-16 266 401
PF08264 Anticodon_1 Anticodon-binding domain of tRNA ligase 6.1E-08 747 834

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15181|SYLM_NEUCR Leucine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-5 PE=3 SV=1 24 921 0.0E+00
sp|P13503|SYLM_SACPA Leucine--tRNA ligase, mitochondrial OS=Saccharomyces paradoxus GN=NAM2 PE=3 SV=1 66 836 0.0E+00
sp|P11325|SYLM_YEAST Leucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM2 PE=1 SV=1 22 836 0.0E+00
sp|Q09828|SYLM_SCHPO Putative leucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.09 PE=3 SV=1 76 819 0.0E+00
sp|P73274|SYL_SYNY3 Leucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuS PE=3 SV=1 33 819 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15181|SYLM_NEUCR Leucine--tRNA ligase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-5 PE=3 SV=1 24 921 0.0E+00
sp|P13503|SYLM_SACPA Leucine--tRNA ligase, mitochondrial OS=Saccharomyces paradoxus GN=NAM2 PE=3 SV=1 66 836 0.0E+00
sp|P11325|SYLM_YEAST Leucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM2 PE=1 SV=1 22 836 0.0E+00
sp|Q09828|SYLM_SCHPO Putative leucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.09 PE=3 SV=1 76 819 0.0E+00
sp|P73274|SYL_SYNY3 Leucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuS PE=3 SV=1 33 819 0.0E+00
sp|Q8DH61|SYL_THEEB Leucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuS PE=3 SV=1 31 819 0.0E+00
sp|B7KCI7|SYL_CYAP7 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=leuS PE=3 SV=1 34 923 0.0E+00
sp|Q7U6T1|SYL_SYNPX Leucine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=leuS PE=3 SV=1 77 819 0.0E+00
sp|B7JYA9|SYL_CYAP8 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=leuS PE=3 SV=1 33 923 0.0E+00
sp|Q7TV01|SYL_PROMM Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=leuS PE=3 SV=1 77 836 0.0E+00
sp|A2C9U0|SYL_PROM3 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=leuS PE=3 SV=1 77 836 0.0E+00
sp|B8HM05|SYL_CYAP4 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuS PE=3 SV=1 34 819 0.0E+00
sp|B1WSK6|SYL_CYAA5 Leucine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=leuS PE=3 SV=1 35 923 0.0E+00
sp|Q0IAE0|SYL_SYNS3 Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=leuS PE=3 SV=1 34 819 0.0E+00
sp|B0C1R1|SYL_ACAM1 Leucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=leuS PE=3 SV=1 75 923 3.0E-178
sp|A5GL71|SYL_SYNPW Leucine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=leuS PE=3 SV=1 34 816 2.0E-177
sp|Q31LW9|SYL_SYNE7 Leucine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=leuS PE=3 SV=1 31 819 2.0E-176
sp|A5GT82|SYL_SYNR3 Leucine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=leuS PE=3 SV=1 34 828 2.0E-176
sp|B1XP90|SYL_SYNP2 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuS PE=3 SV=1 35 819 2.0E-176
sp|Q3AXV7|SYL_SYNS9 Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=leuS PE=3 SV=1 77 828 1.0E-174
sp|Q5N006|SYL_SYNP6 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=leuS PE=3 SV=1 31 819 3.0E-174
sp|A9BAE4|SYL_PROM4 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=leuS PE=3 SV=1 77 877 4.0E-174
sp|Q8YS09|SYL_NOSS1 Leucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuS PE=3 SV=1 33 819 7.0E-174
sp|Q7V1I2|SYL_PROMP Leucine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=leuS PE=3 SV=1 35 921 3.0E-173
sp|Q46L15|SYL_PROMT Leucine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=leuS PE=3 SV=1 77 819 3.0E-173
sp|Q114V5|SYL_TRIEI Leucine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=leuS PE=3 SV=1 34 818 1.0E-172
sp|Q3M3A3|SYL_ANAVT Leucine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuS PE=3 SV=1 35 819 1.0E-172
sp|B2J7T9|SYL_NOSP7 Leucine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=leuS PE=3 SV=1 48 819 2.0E-172
sp|A2BR45|SYL_PROMS Leucine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=leuS PE=3 SV=1 22 893 3.0E-172
sp|Q3AJU8|SYL_SYNSC Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=leuS PE=3 SV=1 77 838 3.0E-172
sp|A2C242|SYL_PROM1 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=leuS PE=3 SV=1 77 819 3.0E-172
sp|A3PCW8|SYL_PROM0 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuS PE=3 SV=1 35 893 5.0E-172
sp|A8G4T7|SYL_PROM2 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=leuS PE=3 SV=1 26 832 7.0E-172
sp|Q2JV13|SYL_SYNJA Leucine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuS PE=3 SV=1 34 819 2.0E-170
sp|Q5RDP4|SYLM_PONAB Probable leucine--tRNA ligase, mitochondrial OS=Pongo abelii GN=LARS2 PE=2 SV=1 75 816 5.0E-169
sp|A2BWL7|SYL_PROM5 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=leuS PE=3 SV=1 35 921 6.0E-169
sp|Q15031|SYLM_HUMAN Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens GN=LARS2 PE=1 SV=2 75 816 6.0E-169
sp|A7HSL7|SYL_PARL1 Leucine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=leuS PE=3 SV=1 34 921 3.0E-168
sp|Q8VDC0|SYLM_MOUSE Probable leucine--tRNA ligase, mitochondrial OS=Mus musculus GN=Lars2 PE=1 SV=1 75 816 9.0E-168
sp|Q7NE01|SYL_GLOVI Leucine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=leuS PE=3 SV=1 75 823 9.0E-167
sp|Q2JHX0|SYL_SYNJB Leucine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuS PE=3 SV=1 34 819 2.0E-166
sp|Q31AX4|SYL_PROM9 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuS PE=3 SV=1 35 832 9.0E-166
sp|Q7VBZ5|SYL_PROMA Leucine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuS PE=3 SV=1 18 836 1.0E-164
sp|A0L4R4|SYL_MAGMM Leucine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=leuS PE=3 SV=1 34 877 1.0E-164
sp|B6JAI4|SYL_OLICO Leucine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=leuS PE=3 SV=1 35 878 1.0E-164
sp|Q0AKF5|SYL_MARMM Leucine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=leuS PE=3 SV=1 77 877 9.0E-164
sp|A4VQZ0|SYL_PSEU5 Leucine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=leuS PE=3 SV=2 77 819 3.0E-163
sp|A8IMK0|SYL_AZOC5 Leucine--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=leuS PE=3 SV=1 38 819 6.0E-163
sp|Q2G3C3|SYL_NOVAD Leucine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=leuS PE=3 SV=1 28 816 2.0E-162
sp|Q5P252|SYL_AROAE Leucine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=leuS PE=3 SV=1 77 817 2.0E-161
sp|Q2WBE4|SYL_MAGSA Leucine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=leuS PE=3 SV=1 36 867 6.0E-161
sp|Q87VX3|SYL_PSESM Leucine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=leuS PE=3 SV=1 77 819 7.0E-161
sp|Q48DN1|SYL_PSE14 Leucine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=leuS PE=3 SV=1 77 819 8.0E-161
sp|Q2K2S7|SYL_RHIEC Leucine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=leuS PE=3 SV=1 38 874 1.0E-160
sp|B0U0E8|SYL_FRAP2 Leucine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=leuS PE=3 SV=1 77 892 1.0E-160
sp|B3CLT1|SYL_WOLPP Leucine--tRNA ligase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=leuS PE=3 SV=1 77 885 1.0E-160
sp|Q4ZN90|SYL_PSEU2 Leucine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=leuS PE=3 SV=1 77 819 1.0E-160
sp|Q4K5H6|SYL_PSEF5 Leucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=leuS PE=3 SV=1 77 819 2.0E-160
sp|B0V5H2|SYL_ACIBY Leucine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=leuS PE=3 SV=1 76 892 4.0E-160
sp|B2HTC4|SYL_ACIBC Leucine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=leuS PE=3 SV=1 76 892 4.0E-160
sp|B7I5I5|SYL_ACIB5 Leucine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=leuS PE=3 SV=1 76 892 4.0E-160
sp|B7H051|SYL_ACIB3 Leucine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=leuS PE=3 SV=1 76 892 6.0E-160
sp|B0VKP9|SYL_ACIBS Leucine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=leuS PE=3 SV=1 76 892 8.0E-160
sp|Q1I4G7|SYL_PSEE4 Leucine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=leuS PE=3 SV=1 77 819 1.0E-159
sp|B0RR06|SYL_XANCB Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=leuS PE=3 SV=2 75 877 1.0E-159
sp|A5CCT4|SYL_ORITB Leucine--tRNA ligase OS=Orientia tsutsugamushi (strain Boryong) GN=leuS PE=3 SV=1 30 819 1.0E-159
sp|Q54ET5|SYLM_DICDI Leucine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mleuS PE=3 SV=1 77 819 2.0E-159
sp|Q3BRE4|SYL_XANC5 Leucine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=leuS PE=3 SV=2 75 877 2.0E-159
sp|Q8PIW4|SYL_XANAC Leucine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=leuS PE=3 SV=1 75 877 2.0E-159
sp|Q0ABN3|SYL_ALKEH Leucine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=leuS PE=3 SV=1 77 819 2.0E-159
sp|Q5NMK1|SYL_ZYMMO Leucine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=leuS PE=3 SV=1 26 867 3.0E-159
sp|B1J150|SYL_PSEPW Leucine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=leuS PE=3 SV=1 77 819 4.0E-159
sp|B6IU54|SYL_RHOCS Leucine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=leuS PE=3 SV=1 77 867 5.0E-159
sp|B0KJW8|SYL_PSEPG Leucine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=leuS PE=3 SV=1 77 836 5.0E-159
sp|Q4UWK8|SYL_XANC8 Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=leuS PE=3 SV=2 75 877 6.0E-159
sp|A4XYW8|SYL_PSEMY Leucine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=leuS PE=3 SV=2 77 819 9.0E-159
sp|A0Q693|SYL_FRATN Leucine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=leuS PE=3 SV=1 77 921 1.0E-158
sp|Q608N7|SYL_METCA Leucine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=leuS PE=3 SV=1 77 822 1.0E-158
sp|Q8P7J1|SYL_XANCP Leucine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=leuS PE=3 SV=2 75 819 1.0E-158
sp|A4IXU1|SYL_FRATW Leucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=leuS PE=3 SV=1 77 921 2.0E-158
sp|Q6F817|SYL_ACIAD Leucine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=leuS PE=3 SV=1 76 892 3.0E-158
sp|B2SGM9|SYL_FRATM Leucine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=leuS PE=3 SV=1 77 921 4.0E-158
sp|Q88DN1|SYL_PSEPK Leucine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=leuS PE=3 SV=1 77 836 5.0E-158
sp|A5W9H9|SYL_PSEP1 Leucine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=leuS PE=3 SV=2 77 836 5.0E-158
sp|C3K2L2|SYL_PSEFS Leucine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=leuS PE=3 SV=1 77 819 5.0E-158
sp|A6V0C2|SYL_PSEA7 Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=leuS PE=3 SV=1 35 819 8.0E-158
sp|Q89WQ1|SYL_BRADU Leucine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=leuS PE=3 SV=1 38 819 1.0E-157
sp|B2SWH2|SYL_XANOP Leucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=leuS PE=3 SV=1 75 877 1.0E-157
sp|Q2J364|SYL_RHOP2 Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=leuS PE=3 SV=1 73 819 1.0E-157
sp|A5G068|SYL_ACICJ Leucine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=leuS PE=3 SV=1 31 826 2.0E-157
sp|A5E8H4|SYL_BRASB Leucine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=leuS PE=3 SV=1 38 900 2.0E-157
sp|Q0BLI7|SYL_FRATO Leucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=leuS PE=3 SV=1 77 921 2.0E-157
sp|Q2A307|SYL_FRATH Leucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=leuS PE=3 SV=1 77 921 2.0E-157
sp|A7NCQ3|SYL_FRATF Leucine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=leuS PE=3 SV=1 77 921 2.0E-157
sp|A5G677|SYL_GEOUR Leucine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=leuS PE=3 SV=1 35 865 2.0E-157
sp|B6J863|SYL_COXB1 Leucine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=leuS PE=3 SV=1 77 921 2.0E-157
sp|Q5NG64|SYL_FRATT Leucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=leuS PE=3 SV=1 77 921 2.0E-157
sp|Q14HL6|SYL_FRAT1 Leucine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=leuS PE=3 SV=1 77 921 2.0E-157
sp|Q5GXI8|SYL_XANOR Leucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=leuS PE=3 SV=1 75 877 3.0E-157
sp|Q74AZ0|SYL_GEOSL Leucine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=leuS PE=3 SV=1 35 921 3.0E-157
sp|Q2P0N0|SYL_XANOM Leucine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=leuS PE=3 SV=1 75 877 3.0E-157
sp|A9KCQ4|SYL_COXBN Leucine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=leuS PE=3 SV=1 77 921 4.0E-157
sp|Q83DY1|SYL_COXBU Leucine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=leuS PE=3 SV=1 77 921 4.0E-157
sp|B6J1B2|SYL_COXB2 Leucine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=leuS PE=3 SV=1 77 921 4.0E-157
sp|Q21CM7|SYL_RHOPB Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=leuS PE=3 SV=1 73 816 5.0E-157
sp|Q1GNP7|SYL_SPHAL Leucine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=leuS PE=3 SV=1 34 819 5.0E-157
sp|Q9A217|SYL_CAUCR Leucine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=leuS PE=3 SV=1 77 816 7.0E-157
sp|B8GW27|SYL_CAUCN Leucine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=leuS PE=3 SV=1 77 816 7.0E-157
sp|Q73IT7|SYL_WOLPM Leucine--tRNA ligase OS=Wolbachia pipientis wMel GN=leuS PE=3 SV=1 77 817 7.0E-157
sp|A9WWT1|SYL_BRUSI Leucine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=leuS PE=3 SV=1 36 876 9.0E-157
sp|A5VSE9|SYL_BRUO2 Leucine--tRNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=leuS PE=3 SV=2 36 876 9.0E-157
sp|Q8YJ44|SYL_BRUME Leucine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=leuS PE=3 SV=1 36 876 9.0E-157
sp|C0RF58|SYL_BRUMB Leucine--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=leuS PE=3 SV=1 36 876 9.0E-157
sp|Q02SF5|SYL_PSEAB Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=leuS PE=3 SV=1 35 819 1.0E-156
sp|Q8FYQ7|SYL_BRUSU Leucine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=leuS PE=3 SV=1 36 876 1.0E-156
sp|A9NC49|SYL_COXBR Leucine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=leuS PE=3 SV=1 77 921 1.0E-156
sp|B7V9C9|SYL_PSEA8 Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=leuS PE=3 SV=1 35 819 1.0E-156
sp|B0U376|SYL_XYLFM Leucine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=leuS PE=3 SV=1 77 859 2.0E-156
sp|Q9HX33|SYL_PSEAE Leucine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=leuS PE=3 SV=1 35 819 2.0E-156
sp|C0R573|SYL_WOLWR Leucine--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=leuS PE=3 SV=1 77 817 2.0E-156
sp|A4YJS8|SYL_BRASO Leucine--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=leuS PE=3 SV=1 38 819 2.0E-156
sp|Q1QRZ8|SYL_NITHX Leucine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=leuS PE=3 SV=1 77 819 2.0E-156
sp|Q2YLH9|SYL_BRUA2 Leucine--tRNA ligase OS=Brucella abortus (strain 2308) GN=leuS PE=3 SV=1 36 876 3.0E-156
sp|B2S7N1|SYL_BRUA1 Leucine--tRNA ligase OS=Brucella abortus (strain S19) GN=leuS PE=3 SV=1 36 876 3.0E-156
sp|Q57B80|SYL_BRUAB Leucine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=leuS PE=3 SV=1 36 876 4.0E-156
sp|Q2RN70|SYL_RHORT Leucine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=leuS PE=3 SV=1 77 819 6.0E-156
sp|A9M845|SYL_BRUC2 Leucine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=leuS PE=3 SV=1 36 876 7.0E-156
sp|B5EE39|SYL_GEOBB Leucine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=leuS PE=3 SV=1 34 865 7.0E-156
sp|Q87C65|SYL_XYLFT Leucine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=leuS PE=3 SV=1 77 819 9.0E-156
sp|B2I5T5|SYL_XYLF2 Leucine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=leuS PE=3 SV=1 77 819 9.0E-156
sp|A1APS3|SYL_PELPD Leucine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=leuS PE=3 SV=1 28 832 2.0E-155
sp|Q3A4P8|SYL_PELCD Leucine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=leuS PE=3 SV=1 31 865 2.0E-155
sp|C6E100|SYL_GEOSM Leucine--tRNA ligase OS=Geobacter sp. (strain M21) GN=leuS PE=3 SV=1 34 865 2.0E-155
sp|Q13E15|SYL_RHOPS Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=leuS PE=3 SV=1 73 819 2.0E-155
sp|Q3SWI2|SYL_NITWN Leucine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=leuS PE=3 SV=1 77 826 3.0E-155
sp|Q98EU7|SYL_RHILO Leucine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=leuS PE=3 SV=1 34 819 3.0E-155
sp|Q3K6B0|SYL_PSEPF Leucine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=leuS PE=3 SV=1 77 819 3.0E-155
sp|Q39T99|SYL_GEOMG Leucine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=leuS PE=3 SV=1 35 832 4.0E-155
sp|C1DA02|SYL_LARHH Leucine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=leuS PE=3 SV=1 77 823 5.0E-155
sp|Q3SG58|SYL_THIDA Leucine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=leuS PE=3 SV=1 77 823 5.0E-155
sp|Q9PBG8|SYL_XYLFA Leucine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=leuS PE=3 SV=2 77 859 6.0E-155
sp|Q8RIQ3|SYL_FUSNN Leucine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=leuS PE=3 SV=1 77 876 6.0E-155
sp|Q6G1W2|SYL_BARHE Leucine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=leuS PE=3 SV=1 34 900 1.0E-154
sp|B4SRE7|SYL_STRM5 Leucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=leuS PE=3 SV=1 77 819 1.0E-154
sp|Q5GS31|SYL_WOLTR Leucine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=leuS PE=3 SV=1 77 817 1.0E-154
sp|Q1GZB5|SYL_METFK Leucine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=leuS PE=3 SV=1 77 877 1.0E-154
sp|Q0BWB5|SYL_HYPNA Leucine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=leuS PE=3 SV=1 38 875 2.0E-154
sp|A6WXW1|SYL_OCHA4 Leucine--tRNA ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=leuS PE=3 SV=1 36 819 2.0E-154
sp|B2FPR7|SYL_STRMK Leucine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=leuS PE=3 SV=1 77 819 3.0E-154
sp|B2JGX6|SYL_BURP8 Leucine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=leuS PE=3 SV=1 75 819 4.0E-154
sp|B3Q8A1|SYL_RHOPT Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=leuS PE=3 SV=1 77 819 6.0E-154
sp|B3PS46|SYL_RHIE6 Leucine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=leuS PE=3 SV=1 38 819 6.0E-154
sp|Q7P0R1|SYL_CHRVO Leucine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuS PE=3 SV=1 77 822 8.0E-154
sp|Q3YSH6|SYL_EHRCJ Leucine--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=leuS PE=3 SV=1 77 865 9.0E-154
sp|Q820M7|SYL_NITEU Leucine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=leuS PE=3 SV=1 77 885 1.0E-153
sp|A4JBI1|SYL_BURVG Leucine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuS PE=3 SV=1 75 819 1.0E-153
sp|C3MB60|SYL_RHISN Leucine--tRNA ligase OS=Rhizobium sp. (strain NGR234) GN=leuS PE=3 SV=1 38 875 1.0E-153
sp|A1UR39|SYL_BARBK Leucine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=leuS PE=3 SV=1 34 891 2.0E-153
sp|Q6FYL6|SYL_BARQU Leucine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=leuS PE=3 SV=1 34 891 3.0E-153
sp|Q13U82|SYL_BURXL Leucine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=leuS PE=3 SV=1 64 877 3.0E-153
sp|Q0AG57|SYL_NITEC Leucine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=leuS PE=3 SV=1 77 877 4.0E-153
sp|Q2GG41|SYL_EHRCR Leucine--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=leuS PE=3 SV=1 67 865 5.0E-153
sp|C1DMV9|SYL_AZOVD Leucine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=leuS PE=3 SV=1 77 819 6.0E-153
sp|A1KAH5|SYL_AZOSB Leucine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=leuS PE=3 SV=1 77 817 6.0E-153
sp|A9IYY8|SYL_BART1 Leucine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=leuS PE=3 SV=1 34 900 7.0E-153
sp|Q3J7S8|SYL_NITOC Leucine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=leuS PE=3 SV=1 77 819 8.0E-153
sp|A5VA89|SYL_SPHWW Leucine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=leuS PE=3 SV=1 36 704 8.0E-153
sp|A6TQK3|SYL_ALKMQ Leucine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=leuS PE=3 SV=1 27 865 2.0E-152
sp|Q31IE8|SYL_THICR Leucine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=leuS PE=3 SV=1 77 819 2.0E-152
sp|A9AHA9|SYL_BURM1 Leucine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuS PE=3 SV=1 75 819 2.0E-152
sp|Q4FU71|SYL_PSYA2 Leucine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=leuS PE=3 SV=1 56 819 3.0E-152
sp|Q5FHG5|SYL_EHRRG Leucine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=leuS PE=3 SV=1 77 819 5.0E-152
sp|B9M9F3|SYL_GEODF Leucine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=leuS PE=3 SV=1 35 819 5.0E-152
sp|C0QI75|SYL_DESAH Leucine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=leuS PE=3 SV=1 77 819 5.0E-152
sp|B5ZV40|SYL_RHILW Leucine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=leuS PE=3 SV=1 38 874 6.0E-152
sp|A1WYZ7|SYL_HALHL Leucine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=leuS PE=3 SV=1 77 816 6.0E-152
sp|A6UEE2|SYL_SINMW Leucine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=leuS PE=3 SV=1 38 891 7.0E-152
sp|A1U4A0|SYL_MARHV Leucine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=leuS PE=3 SV=2 77 862 9.0E-152
sp|Q5HBM8|SYL_EHRRW Leucine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=leuS PE=3 SV=1 77 819 1.0E-151
sp|Q92KW8|SYL_RHIME Leucine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=leuS PE=3 SV=1 38 875 2.0E-151
sp|Q1MA25|SYL2_RHIL3 Leucine--tRNA ligase 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuS2 PE=3 SV=1 38 876 2.0E-151
sp|Q68WV8|SYL_RICTY Leucine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=leuS PE=3 SV=1 32 819 3.0E-151
sp|Q9WY15|SYL_THEMA Leucine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuS PE=3 SV=1 35 921 3.0E-151
sp|Q0BIB5|SYL_BURCM Leucine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuS PE=3 SV=1 75 819 3.0E-151
sp|Q11DE4|SYL_CHESB Leucine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=leuS PE=3 SV=1 77 816 3.0E-151
sp|A4XKG9|SYL_CALS8 Leucine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=leuS PE=3 SV=1 35 879 3.0E-151
sp|Q9ZDB1|SYL_RICPR Leucine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=leuS PE=3 SV=1 35 819 4.0E-151
sp|B4EEW1|SYL_BURCJ Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=leuS PE=3 SV=1 75 819 4.0E-151
sp|B8CXR8|SYL_HALOH Leucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuS PE=3 SV=1 77 819 5.0E-151
sp|Q1RJS2|SYL_RICBR Leucine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=leuS PE=3 SV=1 35 839 7.0E-151
sp|Q2LQK5|SYL_SYNAS Leucine--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=leuS PE=3 SV=1 35 921 7.0E-151
sp|B9JV46|SYL_AGRVS Leucine--tRNA ligase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=leuS PE=3 SV=1 38 876 1.0E-150
sp|Q6ND22|SYL_RHOPA Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=leuS PE=3 SV=1 77 819 1.0E-150
sp|A2S5J4|SYL_BURM9 Leucine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=leuS PE=3 SV=1 77 819 2.0E-150
sp|A3MPH9|SYL_BURM7 Leucine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=leuS PE=3 SV=1 77 819 2.0E-150
sp|Q6AJZ7|SYL_DESPS Leucine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=leuS PE=3 SV=1 31 819 2.0E-150
sp|A0K4I0|SYL_BURCH Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=leuS PE=3 SV=1 75 819 2.0E-150
sp|Q1BZ70|SYL_BURCA Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=leuS PE=3 SV=1 75 819 2.0E-150
sp|A1V0G7|SYL_BURMS Leucine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=leuS PE=3 SV=1 77 819 2.0E-150
sp|Q62H20|SYL_BURMA Leucine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=leuS PE=3 SV=1 77 819 2.0E-150
sp|B1YTA7|SYL_BURA4 Leucine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=leuS PE=3 SV=1 75 819 2.0E-150
sp|B1JVG9|SYL_BURCC Leucine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=leuS PE=3 SV=1 75 819 2.0E-150
sp|Q2SZ91|SYL_BURTA Leucine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=leuS PE=3 SV=2 77 819 2.0E-150
sp|Q0BW99|SYL_GRABC Leucine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=leuS PE=3 SV=1 28 819 4.0E-150
sp|Q1LJ30|SYL_CUPMC Leucine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=leuS PE=3 SV=1 64 826 6.0E-150
sp|A8F1J5|SYL_RICM5 Leucine--tRNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=leuS PE=3 SV=1 32 819 7.0E-150
sp|A8GS16|SYL_RICRS Leucine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=leuS PE=3 SV=1 32 819 8.0E-150
sp|B0BXI2|SYL_RICRO Leucine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=leuS PE=3 SV=1 32 819 8.0E-150
sp|A5WGH9|SYL_PSYWF Leucine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=leuS PE=3 SV=1 76 782 8.0E-150
sp|A3NDK5|SYL_BURP6 Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=leuS PE=3 SV=1 77 819 9.0E-150
sp|B2A6C2|SYL_NATTJ Leucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=leuS PE=3 SV=1 35 819 1.0E-149
sp|Q63QT6|SYL_BURPS Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=leuS PE=3 SV=1 77 819 1.0E-149
sp|A3NZB6|SYL_BURP0 Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=leuS PE=3 SV=1 77 819 1.0E-149
sp|Q8UBV2|SYL_AGRFC Leucine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=leuS PE=3 SV=1 38 819 1.0E-149
sp|Q92I35|SYL_RICCN Leucine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=leuS PE=3 SV=1 32 819 2.0E-149
sp|Q3JNN1|SYL_BURP1 Leucine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=leuS PE=3 SV=2 77 819 2.0E-149
sp|Q1QDA4|SYL_PSYCK Leucine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=leuS PE=3 SV=2 56 813 2.0E-149
sp|Q39JM5|SYL_BURL3 Leucine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuS PE=3 SV=1 75 819 2.0E-149
sp|B8F9F0|SYL_DESAA Leucine--tRNA ligase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=leuS PE=3 SV=1 77 900 3.0E-149
sp|Q46XD8|SYL_CUPPJ Leucine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=leuS PE=3 SV=2 75 819 4.0E-149
sp|A5IBJ1|SYL_LEGPC Leucine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=leuS PE=3 SV=1 77 819 4.0E-149
sp|Q2GDQ6|SYL_NEOSM Leucine--tRNA ligase OS=Neorickettsia sennetsu (strain Miyayama) GN=leuS PE=3 SV=2 77 813 5.0E-149
sp|Q4ULS1|SYL_RICFE Leucine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=leuS PE=3 SV=1 32 819 6.0E-149
sp|Q5ZVU2|SYL_LEGPH Leucine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=leuS PE=3 SV=1 77 819 8.0E-149
sp|Q5X5L8|SYL_LEGPA Leucine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=leuS PE=3 SV=1 77 819 1.0E-148
sp|B8EQP4|SYL_METSB Leucine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=leuS PE=3 SV=1 73 819 1.0E-148
sp|C3PNE7|SYL_RICAE Leucine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=leuS PE=3 SV=1 32 819 2.0E-148
sp|Q5WWZ8|SYL_LEGPL Leucine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=leuS PE=3 SV=1 77 819 2.0E-148
sp|A8GNE3|SYL_RICAH Leucine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=leuS PE=3 SV=1 32 819 2.0E-148
sp|C0QWR3|SYL_BRAHW Leucine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=leuS PE=3 SV=1 31 819 2.0E-148
sp|A9M162|SYL_NEIM0 Leucine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=leuS PE=3 SV=2 77 819 3.0E-148
sp|A5IKQ3|SYL_THEP1 Leucine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=leuS PE=3 SV=1 35 921 3.0E-148
sp|B4RCZ4|SYL_PHEZH Leucine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=leuS PE=3 SV=1 36 816 3.0E-148
sp|A3DEU0|SYL_CLOTH Leucine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuS PE=3 SV=1 35 832 5.0E-148
sp|C4K297|SYL_RICPU Leucine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=leuS PE=3 SV=1 32 819 5.0E-148
sp|Q8XVT3|SYL_RALSO Leucine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=leuS PE=3 SV=1 75 877 1.0E-147
sp|Q24SP5|SYL_DESHY Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=leuS PE=3 SV=1 32 819 1.0E-147
sp|B8FUR3|SYL_DESHD Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=leuS PE=3 SV=1 32 819 1.0E-147
sp|A6LJM9|SYL_THEM4 Leucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=leuS PE=3 SV=1 33 819 3.0E-147
sp|A1AV52|SYL_RUTMC Leucine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=leuS PE=3 SV=1 77 892 3.0E-147
sp|B2UCA1|SYL_RALPJ Leucine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=leuS PE=3 SV=1 75 877 3.0E-147
sp|A7HN82|SYL_FERNB Leucine--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=leuS PE=3 SV=1 35 819 4.0E-147
sp|Q5FAJ3|SYL_NEIG1 Leucine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=leuS PE=3 SV=2 77 819 4.0E-147
sp|B4RNT1|SYL_NEIG2 Leucine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=leuS PE=3 SV=1 77 819 4.0E-147
sp|A4SVD9|SYL_POLSQ Leucine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=leuS PE=3 SV=1 77 877 5.0E-147
sp|B0T6E7|SYL_CAUSK Leucine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=leuS PE=3 SV=1 77 823 6.0E-147
sp|A2SC91|SYL_METPP Leucine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=leuS PE=3 SV=1 75 823 9.0E-147
sp|A1VEL2|SYL_DESVV Leucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuS PE=3 SV=1 31 819 2.0E-146
sp|Q72CT7|SYL_DESVH Leucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuS PE=3 SV=1 31 819 3.0E-146
sp|Q47IN0|SYL_DECAR Leucine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=leuS PE=3 SV=2 77 836 3.0E-146
sp|Q484Q5|SYL_COLP3 Leucine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=leuS PE=3 SV=1 77 877 3.0E-146
sp|Q5PB38|SYL_ANAMM Leucine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=leuS PE=3 SV=1 43 816 5.0E-146
sp|A8EZ02|SYL_RICCK Leucine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=leuS PE=3 SV=1 32 819 5.0E-146
sp|Q3AF30|SYL_CARHZ Leucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuS PE=3 SV=1 31 819 9.0E-146
sp|Q2YBQ2|SYL_NITMU Leucine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=leuS PE=3 SV=1 77 822 1.0E-145
sp|A8F8B7|SYL_PSELT Leucine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=leuS PE=3 SV=1 35 899 2.0E-145
sp|A9BF22|SYL_PETMO Leucine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=leuS PE=3 SV=1 28 865 2.0E-145
sp|A6T239|SYL_JANMA Leucine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=leuS PE=3 SV=1 77 819 2.0E-145
sp|A4G8E6|SYL_HERAR Leucine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=leuS PE=3 SV=1 77 875 3.0E-145
sp|Q2RKZ1|SYL_MOOTA Leucine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=leuS PE=3 SV=1 75 819 3.0E-145
sp|Q07UN5|SYL_RHOP5 Leucine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=leuS PE=3 SV=1 73 823 5.0E-145
sp|B1I5R7|SYL_DESAP Leucine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=leuS PE=3 SV=1 77 789 6.0E-145
sp|A1B5Q5|SYL_PARDP Leucine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=leuS PE=3 SV=1 38 816 1.0E-144
sp|Q30YL0|SYL_DESAG Leucine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=leuS PE=3 SV=1 34 819 1.0E-144
sp|Q5QYD1|SYL_IDILO Leucine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=leuS PE=3 SV=1 77 865 2.0E-144
sp|Q5FTV3|SYL_GLUOX Leucine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=leuS PE=3 SV=1 61 921 2.0E-144
sp|Q182K8|SYL_PEPD6 Leucine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=leuS PE=3 SV=1 27 828 2.0E-144
sp|B8GV13|SYL_THISH Leucine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=leuS PE=3 SV=1 34 826 3.0E-144
sp|A1KS07|SYL_NEIMF Leucine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuS PE=3 SV=1 77 819 9.0E-144
sp|A9MKC8|SYL_SALAR Leucine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=leuS PE=3 SV=1 35 819 1.0E-143
sp|A8AJG0|SYL_CITK8 Leucine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=leuS PE=3 SV=2 35 819 1.0E-143
sp|A9HWW6|SYL_BORPD Leucine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=leuS PE=3 SV=1 34 819 2.0E-143
sp|Q9JXT2|SYL_NEIMB Leucine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuS PE=1 SV=1 77 819 2.0E-143
sp|Q9JW39|SYL_NEIMA Leucine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuS PE=3 SV=1 77 819 3.0E-143
sp|B2VBM4|SYL_ERWT9 Leucine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=leuS PE=3 SV=1 35 823 5.0E-143
sp|Q0AWK4|SYL_SYNWW Leucine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=leuS PE=3 SV=1 31 865 5.0E-143
sp|A5CY09|SYL_VESOH Leucine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=leuS PE=3 SV=1 77 865 8.0E-143
sp|Q67SB4|SYL_SYMTH Leucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuS PE=3 SV=1 28 832 8.0E-143
sp|Q2SBE7|SYL_HAHCH Leucine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=leuS PE=3 SV=1 77 819 1.0E-142
sp|Q2NUU7|SYL_SODGM Leucine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=leuS PE=3 SV=1 73 921 1.0E-142
sp|Q2KXE5|SYL_BORA1 Leucine--tRNA ligase OS=Bordetella avium (strain 197N) GN=leuS PE=3 SV=1 75 823 3.0E-142
sp|C5BGC7|SYL_EDWI9 Leucine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=leuS PE=3 SV=1 77 836 3.0E-142
sp|Q1MS17|SYL_LAWIP Leucine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=leuS PE=3 SV=1 31 819 6.0E-142
sp|B9KCS8|SYL_CAMLR Leucine--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=leuS PE=3 SV=1 33 894 8.0E-142
sp|A1SU60|SYL_PSYIN Leucine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=leuS PE=3 SV=1 77 877 1.0E-141
sp|Q7W9M4|SYL_BORPA Leucine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=leuS PE=3 SV=1 75 819 1.0E-141
sp|Q7WH33|SYL_BORBR Leucine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=leuS PE=3 SV=1 75 819 2.0E-141
sp|Q7VWY7|SYL_BORPE Leucine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=leuS PE=3 SV=1 75 819 3.0E-141
sp|A7NFJ2|SYL_ROSCS Leucine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=leuS PE=3 SV=1 23 897 3.0E-141
sp|B1XT72|SYL_POLNS Leucine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=leuS PE=3 SV=1 77 817 8.0E-141
sp|Q87RQ0|SYL_VIBPA Leucine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=leuS PE=3 SV=1 77 877 2.0E-140
sp|B5R7Z6|SYL_SALG2 Leucine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=leuS PE=3 SV=1 35 819 3.0E-140
sp|Q7N755|SYL_PHOLL Leucine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=leuS PE=3 SV=1 77 824 3.0E-140
sp|Q1RER9|SYL_ECOUT Leucine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=leuS PE=3 SV=2 35 819 3.0E-140
sp|A1A8R7|SYL_ECOK1 Leucine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=leuS PE=3 SV=2 35 819 3.0E-140
sp|B7MFR5|SYL_ECO45 Leucine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=leuS PE=3 SV=1 35 819 3.0E-140
sp|B5QVP9|SYL_SALEP Leucine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=leuS PE=3 SV=1 35 819 4.0E-140
sp|Q8K9B9|SYL_BUCAP Leucine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=leuS PE=3 SV=1 77 887 4.0E-140
sp|Q220P5|SYL_RHOFT Leucine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=leuS PE=3 SV=1 77 875 4.0E-140
sp|A7MQS0|SYL_CROS8 Leucine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=leuS PE=3 SV=1 77 819 5.0E-140
sp|A1WGU0|SYL_VEREI Leucine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=leuS PE=3 SV=1 77 877 6.0E-140
sp|P43827|SYL_HAEIN Leucine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=leuS PE=3 SV=1 77 819 6.0E-140
sp|Q122Q4|SYL_POLSJ Leucine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=leuS PE=3 SV=1 77 921 8.0E-140
sp|A4J7H2|SYL_DESRM Leucine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=leuS PE=3 SV=1 31 816 1.0E-139
sp|Q1QV15|SYL_CHRSD Leucine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=leuS PE=3 SV=1 77 863 1.0E-139
sp|Q1LTM9|SYL_BAUCH Leucine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=leuS PE=3 SV=1 77 921 1.0E-139
sp|B1KDW0|SYL_SHEWM Leucine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=leuS PE=3 SV=1 77 819 1.0E-139
sp|A7MY86|SYL_VIBCB Leucine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=leuS PE=3 SV=1 77 877 1.0E-139
sp|Q8ZQZ6|SYL_SALTY Leucine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|B5FMP4|SYL_SALDC Leucine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|C0PW78|SYL_SALPC Leucine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|B4SYK7|SYL_SALNS Leucine--tRNA ligase OS=Salmonella newport (strain SL254) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|B4TB51|SYL_SALHS Leucine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|B5EZ89|SYL_SALA4 Leucine--tRNA ligase OS=Salmonella agona (strain SL483) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|B9KMH8|SYL_RHOSK Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=leuS PE=3 SV=1 27 819 2.0E-139
sp|A3PMN4|SYL_RHOS1 Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=leuS PE=3 SV=1 27 819 2.0E-139
sp|Q28VD4|SYL_JANSC Leucine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=leuS PE=3 SV=1 77 816 2.0E-139
sp|A6T6A3|SYL_KLEP7 Leucine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=leuS PE=3 SV=1 77 819 2.0E-139
sp|Q83LX5|SYL_SHIFL Leucine--tRNA ligase OS=Shigella flexneri GN=leuS PE=3 SV=2 35 819 2.0E-139
sp|Q57RS7|SYL_SALCH Leucine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=leuS PE=3 SV=2 35 819 2.0E-139
sp|A7ZJ31|SYL_ECO24 Leucine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=leuS PE=3 SV=1 35 819 2.0E-139
sp|Q8FJY9|SYL_ECOL6 Leucine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=leuS PE=3 SV=2 35 819 3.0E-139
sp|B7MRS9|SYL_ECO81 Leucine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|B4TPX5|SYL_SALSV Leucine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|A9MUK3|SYL_SALPB Leucine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|Q3IZL4|SYL_RHOS4 Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=leuS PE=3 SV=1 27 819 3.0E-139
sp|Q0TK31|SYL_ECOL5 Leucine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|Q1GKN8|SYL_RUEST Leucine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=leuS PE=3 SV=1 27 816 3.0E-139
sp|B5YQJ4|SYL_ECO5E Leucine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|Q8XBN8|SYL_ECO57 Leucine--tRNA ligase OS=Escherichia coli O157:H7 GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|B2TU77|SYL_SHIB3 Leucine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|B1LL91|SYL_ECOSM Leucine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=leuS PE=3 SV=1 35 819 3.0E-139
sp|Q0I5C5|SYL_HAES1 Leucine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=leuS PE=3 SV=1 77 920 4.0E-139
sp|A7ZXR8|SYL_ECOHS Leucine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=leuS PE=3 SV=1 35 819 4.0E-139
sp|A5UDF4|SYL_HAEIE Leucine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=leuS PE=3 SV=1 77 819 4.0E-139
sp|B7NM01|SYL_ECO7I Leucine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=leuS PE=3 SV=1 35 819 4.0E-139
sp|B7LLH1|SYL_ESCF3 Leucine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=leuS PE=3 SV=1 35 819 5.0E-139
sp|B7M5G9|SYL_ECO8A Leucine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=leuS PE=3 SV=1 35 819 5.0E-139
sp|B7L9I6|SYL_ECO55 Leucine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=leuS PE=3 SV=1 35 819 5.0E-139
sp|A4SJW8|SYL_AERS4 Leucine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=leuS PE=3 SV=1 77 877 5.0E-139
sp|Q3Z4F0|SYL_SHISS Leucine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=leuS PE=3 SV=1 35 819 5.0E-139
sp|Q324Q2|SYL_SHIBS Leucine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=leuS PE=3 SV=1 35 819 5.0E-139
sp|B7UKT2|SYL_ECO27 Leucine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=leuS PE=3 SV=1 35 819 6.0E-139
sp|B6I153|SYL_ECOSE Leucine--tRNA ligase OS=Escherichia coli (strain SE11) GN=leuS PE=3 SV=1 35 819 7.0E-139
sp|Q32IT9|SYL_SHIDS Leucine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=leuS PE=3 SV=1 35 819 8.0E-139
sp|A5V1W3|SYL_ROSS1 Leucine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=leuS PE=3 SV=1 76 900 9.0E-139
sp|A8FZ10|SYL_SHESH Leucine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=leuS PE=3 SV=1 77 819 9.0E-139
sp|P07813|SYL_ECOLI Leucine--tRNA ligase OS=Escherichia coli (strain K12) GN=leuS PE=1 SV=2 35 819 9.0E-139
sp|C4ZWC9|SYL_ECOBW Leucine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=leuS PE=3 SV=1 35 819 9.0E-139
sp|B1IYG6|SYL_ECOLC Leucine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=leuS PE=3 SV=1 35 819 1.0E-138
sp|A0KN87|SYL_AERHH Leucine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=leuS PE=3 SV=2 77 877 1.0E-138
sp|Q4QLY8|SYL_HAEI8 Leucine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=leuS PE=3 SV=1 77 819 1.0E-138
sp|Q8Z8H5|SYL_SALTI Leucine--tRNA ligase OS=Salmonella typhi GN=leuS PE=3 SV=1 35 819 1.0E-138
sp|C5CJ85|SYL_VARPS Leucine--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=leuS PE=3 SV=1 77 819 1.0E-138
sp|Q492Z3|SYL_BLOPB Leucine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=leuS PE=3 SV=1 77 836 2.0E-138
sp|B7VKF7|SYL_VIBTL Leucine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=leuS PE=3 SV=1 77 877 2.0E-138
sp|A1TVU7|SYL_ACIAC Leucine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=leuS PE=3 SV=1 77 877 2.0E-138
sp|B5BCE6|SYL_SALPK Leucine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=leuS PE=3 SV=1 35 819 2.0E-138
sp|Q5PM88|SYL_SALPA Leucine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=leuS PE=3 SV=1 35 819 2.0E-138
sp|B0URM9|SYL_HISS2 Leucine--tRNA ligase OS=Histophilus somni (strain 2336) GN=leuS PE=3 SV=1 77 865 2.0E-138
sp|B5XZR2|SYL_KLEP3 Leucine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=leuS PE=3 SV=1 77 819 3.0E-138
sp|Q47MY0|SYL_THEFY Leucine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=leuS PE=3 SV=1 29 819 3.0E-138
sp|B7N9P8|SYL_ECOLU Leucine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=leuS PE=3 SV=1 35 819 4.0E-138
sp|A5UI62|SYL_HAEIG Leucine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=leuS PE=3 SV=1 77 819 5.0E-138
sp|Q0T6Q2|SYL_SHIF8 Leucine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=leuS PE=3 SV=2 35 819 5.0E-138
sp|B0RDA6|SYL_CLAMS Leucine--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=leuS PE=3 SV=1 28 819 5.0E-138
sp|B8DJF0|SYL_DESVM Leucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=leuS PE=3 SV=1 31 816 5.0E-138
sp|A1S8S8|SYL_SHEAM Leucine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=leuS PE=3 SV=2 77 877 7.0E-138
sp|A5F2X0|SYL_VIBC3 Leucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=leuS PE=3 SV=2 77 877 8.0E-138
sp|A1JQ25|SYL_YERE8 Leucine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=leuS PE=3 SV=1 77 876 1.0E-137
sp|A0LSY4|SYL_ACIC1 Leucine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=leuS PE=3 SV=1 28 863 1.0E-137
sp|B1XXY5|SYL_LEPCP Leucine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=leuS PE=3 SV=1 68 823 1.0E-137
sp|Q9HN72|SYL_HALSA Leucine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=leuS PE=3 SV=1 29 836 2.0E-137
sp|A5CR89|SYL_CLAM3 Leucine--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=leuS PE=3 SV=1 28 819 2.0E-137
sp|Q7VRA6|SYL_BLOFL Leucine--tRNA ligase OS=Blochmannia floridanus GN=leuS PE=3 SV=1 77 877 2.0E-137
sp|Q01U81|SYL_SOLUE Leucine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=leuS PE=3 SV=1 75 832 2.0E-137
sp|A7GZ81|SYL_CAMC5 Leucine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=leuS PE=3 SV=1 35 820 2.0E-137
sp|Q65VR5|SYL_MANSM Leucine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=leuS PE=3 SV=1 77 819 3.0E-137
sp|Q6D7L6|SYL_PECAS Leucine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=leuS PE=3 SV=1 77 921 3.0E-137
sp|A8GB21|SYL_SERP5 Leucine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=leuS PE=3 SV=1 77 819 4.0E-137
sp|A4WXA5|SYL_RHOS5 Leucine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=leuS PE=3 SV=1 27 819 4.0E-137
sp|Q9KTE6|SYL_VIBCH Leucine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=leuS PE=3 SV=2 77 877 6.0E-137
sp|B0TR44|SYL_SHEHH Leucine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=leuS PE=3 SV=2 77 809 7.0E-137
sp|A3QH47|SYL_SHELP Leucine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=leuS PE=3 SV=1 77 819 1.0E-136
sp|A8H7C2|SYL_SHEPA Leucine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=leuS PE=3 SV=2 77 819 2.0E-136
sp|A1VTV4|SYL_POLNA Leucine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=leuS PE=3 SV=1 77 823 2.0E-136
sp|Q15VK0|SYL_PSEA6 Leucine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=leuS PE=3 SV=1 77 819 2.0E-136
sp|Q8EHP4|SYL_SHEON Leucine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=leuS PE=3 SV=1 77 877 3.0E-136
sp|A9R6Z0|SYL_YERPG Leucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|Q66DE3|SYL_YERPS Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|A4TNZ7|SYL_YERPP Leucine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|Q1CKQ4|SYL_YERPN Leucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|Q8ZDF8|SYL_YERPE Leucine--tRNA ligase OS=Yersinia pestis GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|B2K886|SYL_YERPB Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|Q1C521|SYL_YERPA Leucine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|A7FKW0|SYL_YERP3 Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|B1JGA5|SYL_YERPY Leucine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=leuS PE=3 SV=1 77 876 3.0E-136
sp|Q8DFE2|SYL_VIBVU Leucine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=leuS PE=3 SV=1 77 877 4.0E-136
sp|A0KTW7|SYL_SHESA Leucine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=leuS PE=3 SV=1 77 877 4.0E-136
sp|P57519|SYL_BUCAI Leucine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=leuS PE=3 SV=1 77 819 5.0E-136
sp|Q0VN53|SYL_ALCBS Leucine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=leuS PE=3 SV=2 77 879 5.0E-136
sp|A8ERV3|SYL_ARCB4 Leucine--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=leuS PE=3 SV=1 35 843 5.0E-136
sp|A5D416|SYL_PELTS Leucine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=leuS PE=3 SV=1 44 816 6.0E-136
sp|B3PIB4|SYL_CELJU Leucine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=leuS PE=3 SV=1 77 816 7.0E-136
sp|Q0HXU4|SYL_SHESR Leucine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=leuS PE=3 SV=1 77 877 1.0E-135
sp|B4EV14|SYL_PROMH Leucine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=leuS PE=3 SV=1 77 877 1.0E-135
sp|O66680|SYLA_AQUAE Leucine--tRNA ligase subunit alpha OS=Aquifex aeolicus (strain VF5) GN=leuS PE=1 SV=1 73 611 2.0E-135
sp|Q7MN06|SYL_VIBVY Leucine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=leuS PE=3 SV=1 77 877 2.0E-135
sp|Q5HU13|SYL_CAMJR Leucine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=leuS PE=3 SV=1 35 820 2.0E-135
sp|Q16E06|SYL_ROSDO Leucine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=leuS PE=3 SV=1 35 816 2.0E-135
sp|A7H2R6|SYL_CAMJD Leucine--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=leuS PE=3 SV=1 35 820 2.0E-135
sp|A9C1G8|SYL_DELAS Leucine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=leuS PE=3 SV=1 75 892 3.0E-135
sp|Q6LN98|SYL_PHOPR Leucine--tRNA ligase OS=Photobacterium profundum GN=leuS PE=3 SV=1 77 877 3.0E-135
sp|B9MH67|SYL_ACIET Leucine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=leuS PE=3 SV=1 75 819 3.0E-135
sp|A1R6X5|SYL_ARTAT Leucine--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=leuS PE=3 SV=2 32 819 3.0E-135
sp|A7ZE39|SYL_CAMC1 Leucine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=leuS PE=3 SV=1 35 820 3.0E-135
sp|A0LK15|SYL_SYNFM Leucine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=leuS PE=3 SV=1 35 865 4.0E-135
sp|Q7VM66|SYL_HAEDU Leucine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=leuS PE=3 SV=1 77 865 4.0E-135
sp|Q0HLJ0|SYL_SHESM Leucine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=leuS PE=3 SV=1 77 877 4.0E-135
sp|A1WCP8|SYL_ACISJ Leucine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=leuS PE=3 SV=1 75 819 4.0E-135
sp|Q8XML8|SYL_CLOPE Leucine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=leuS PE=3 SV=1 34 865 5.0E-135
sp|Q7M926|SYL_WOLSU Leucine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=leuS PE=3 SV=1 34 809 5.0E-135
sp|Q0SV78|SYL_CLOPS Leucine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=leuS PE=3 SV=1 34 865 5.0E-135
sp|C6DBW8|SYL_PECCP Leucine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=leuS PE=3 SV=1 77 921 7.0E-135
sp|B2KB05|SYL_ELUMP Leucine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=leuS PE=3 SV=1 27 816 9.0E-135
sp|A6VMB8|SYL_ACTSZ Leucine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=leuS PE=3 SV=1 77 819 1.0E-134
sp|A8LJY0|SYL_DINSH Leucine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=leuS PE=3 SV=1 77 819 1.0E-134
sp|A6WRJ9|SYL_SHEB8 Leucine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=leuS PE=3 SV=2 77 877 1.0E-134
sp|A0JX57|SYL_ARTS2 Leucine--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=leuS PE=3 SV=1 12 831 1.0E-134
sp|A8FME4|SYL_CAMJ8 Leucine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=leuS PE=3 SV=1 35 820 2.0E-134
sp|A1RGU5|SYL_SHESW Leucine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=leuS PE=3 SV=1 77 877 2.0E-134
sp|Q17YZ0|SYL_HELAH Leucine--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=leuS PE=3 SV=1 30 921 2.0E-134
sp|A6Q512|SYL_NITSB Leucine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=leuS PE=3 SV=1 31 832 2.0E-134
sp|Q087K2|SYL_SHEFN Leucine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=leuS PE=3 SV=2 77 819 2.0E-134
sp|A3D7N6|SYL_SHEB5 Leucine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=leuS PE=3 SV=2 77 877 3.0E-134
sp|B8E4X7|SYL_SHEB2 Leucine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=leuS PE=3 SV=1 77 877 3.0E-134
sp|A9L001|SYL_SHEB9 Leucine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=leuS PE=3 SV=2 77 877 4.0E-134
sp|A6WDL7|SYL_KINRD Leucine--tRNA ligase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=leuS PE=3 SV=1 28 877 5.0E-134
sp|Q12R39|SYL_SHEDO Leucine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=leuS PE=3 SV=2 77 819 5.0E-134
sp|Q9PNK3|SYL_CAMJE Leucine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=leuS PE=3 SV=1 35 820 6.0E-134
sp|P57923|SYL_PASMU Leucine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=leuS PE=3 SV=1 77 819 8.0E-134
sp|Q1CR59|SYL_HELPH Leucine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=leuS PE=3 SV=1 30 921 1.0E-133
sp|A4Y9E9|SYL_SHEPC Leucine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=leuS PE=3 SV=1 77 877 1.0E-133
sp|A1W078|SYL_CAMJJ Leucine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=leuS PE=3 SV=1 35 820 1.0E-133
sp|P56457|SYL_HELPY Leucine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=leuS PE=3 SV=1 30 921 3.0E-133
sp|B5FBK7|SYL_VIBFM Leucine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=leuS PE=3 SV=1 77 877 4.0E-133
sp|A6VZE7|SYL_MARMS Leucine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=leuS PE=3 SV=1 77 819 4.0E-133
sp|Q5E6U8|SYL_VIBF1 Leucine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=leuS PE=3 SV=1 77 877 4.0E-133
sp|B0TBJ3|SYL_HELMI Leucine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuS PE=3 SV=1 31 819 5.0E-133
sp|Q9ZJ63|SYL_HELPJ Leucine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=leuS PE=3 SV=1 30 820 1.0E-132
sp|A7I0M0|SYL_CAMHC Leucine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=leuS PE=3 SV=1 31 823 2.0E-132
sp|B0BPF7|SYL_ACTPJ Leucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=leuS PE=3 SV=1 77 819 2.0E-132
sp|A3N0N2|SYL_ACTP2 Leucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=leuS PE=3 SV=1 77 819 2.0E-132
sp|Q9PKI4|SYL_CHLMU Leucine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=leuS PE=3 SV=1 31 885 2.0E-132
sp|B6EIN2|SYL_ALISL Leucine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=leuS PE=3 SV=1 77 877 3.0E-132
sp|Q822R7|SYL_CHLCV Leucine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=leuS PE=3 SV=1 31 867 3.0E-132
sp|B3H1L1|SYL_ACTP7 Leucine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=leuS PE=3 SV=1 77 877 6.0E-132
sp|A5EWD6|SYL_DICNV Leucine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=leuS PE=3 SV=1 77 819 2.0E-131
sp|C4K7R7|SYL_HAMD5 Leucine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=leuS PE=3 SV=1 77 819 5.0E-131
sp|A9WS85|SYL_RENSM Leucine--tRNA ligase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=leuS PE=3 SV=2 31 842 6.0E-131
sp|Q5L5Q6|SYL_CHLAB Leucine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=leuS PE=3 SV=1 31 921 1.0E-130
sp|Q0TTD0|SYL_CLOP1 Leucine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=leuS PE=3 SV=1 34 865 2.0E-130
sp|Q83HV5|SYL_TROW8 Leucine--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=leuS PE=3 SV=1 34 863 2.0E-130
sp|Q83GC6|SYL_TROWT Leucine--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=leuS PE=3 SV=1 34 863 2.0E-130
sp|P59433|SYL_BUCBP Leucine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=leuS PE=3 SV=1 77 877 5.0E-130
sp|A0RNX3|SYL_CAMFF Leucine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=leuS PE=3 SV=1 35 820 7.0E-130
sp|Q21FG6|SYL_SACD2 Leucine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=leuS PE=3 SV=1 77 817 1.0E-129
sp|Q1J0W5|SYL_DEIGD Leucine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=leuS PE=3 SV=1 34 817 1.0E-129
sp|Q254X5|SYL_CHLFF Leucine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=leuS PE=3 SV=1 31 921 2.0E-129
sp|Q9RSF0|SYL_DEIRA Leucine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuS PE=3 SV=2 34 816 1.0E-128
sp|Q73K81|SYL_TREDE Leucine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=leuS PE=3 SV=1 32 863 2.0E-128
sp|Q5LMY0|SYL_RUEPO Leucine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=leuS PE=3 SV=1 35 816 8.0E-128
sp|Q3KMF3|SYL_CHLTA Leucine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=leuS PE=3 SV=1 31 921 9.0E-128
sp|Q30Q82|SYL_SULDN Leucine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=leuS PE=3 SV=1 35 820 3.0E-127
sp|O84211|SYL_CHLTR Leucine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=leuS PE=3 SV=1 31 921 4.0E-127
sp|Q9Z930|SYL_CHLPN Leucine--tRNA ligase OS=Chlamydia pneumoniae GN=leuS PE=3 SV=1 31 921 4.0E-127
sp|Q7VIY7|SYL_HELHP Leucine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=leuS PE=3 SV=1 35 818 1.0E-126
sp|A6M268|SYL_CLOB8 Leucine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=leuS PE=3 SV=1 35 865 2.0E-126
sp|Q3ZWQ1|SYL_DEHMC Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=leuS PE=3 SV=1 36 816 3.0E-126
sp|A5FP73|SYL_DEHMB Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=leuS PE=3 SV=1 36 816 2.0E-125
sp|Q1AR71|SYL_RUBXD Leucine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuS PE=3 SV=1 77 819 2.0E-125
sp|Q057G3|SYL_BUCCC Leucine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=leuS PE=3 SV=1 77 858 2.0E-125
sp|Q3ZA07|SYL_DEHM1 Leucine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=leuS PE=3 SV=1 73 816 2.0E-125
sp|B0BBI9|SYL_CHLTB Leucine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=leuS PE=3 SV=1 31 921 3.0E-125
sp|B0B9V9|SYL_CHLT2 Leucine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=leuS PE=3 SV=1 31 921 3.0E-125
sp|Q3IJ93|SYL_PSEHT Leucine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=leuS PE=3 SV=1 77 877 3.0E-125
sp|A9AZ11|SYL_HERA2 Leucine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuS PE=3 SV=1 77 921 7.0E-125
sp|Q8RCT6|SYL_CALS4 Leucine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuS PE=3 SV=1 35 921 8.0E-125
sp|A5N399|SYL_CLOK5 Leucine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuS PE=3 SV=1 36 879 1.0E-124
sp|Q8CNU8|SYL_STAES Leucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=leuS PE=3 SV=2 35 879 2.0E-123
sp|Q5HNF1|SYL_STAEQ Leucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=leuS PE=3 SV=1 35 879 2.0E-123
sp|B1HXY7|SYL_LYSSC Leucine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=leuS PE=3 SV=1 35 892 3.0E-123
sp|A5HY79|SYL_CLOBH Leucine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=leuS PE=3 SV=1 35 920 4.0E-123
sp|A7FPP5|SYL_CLOB1 Leucine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=leuS PE=3 SV=1 35 920 4.0E-123
sp|C5D6D7|SYL_GEOSW Leucine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=leuS PE=3 SV=1 35 819 5.0E-123
sp|Q5KW09|SYL_GEOKA Leucine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=leuS PE=3 SV=1 35 920 7.0E-123
sp|A4W827|SYL_ENT38 Leucine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=leuS PE=3 SV=1 35 921 2.0E-122
sp|A7G9T9|SYL_CLOBL Leucine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=leuS PE=3 SV=1 35 876 3.0E-122
sp|Q48VJ7|SYL_STRPM Leucine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=leuS PE=3 SV=1 27 879 5.0E-122
sp|Q1MFI6|SYL1_RHIL3 Leucine--tRNA ligase 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=leuS1 PE=3 SV=1 35 839 8.0E-122
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0002161 aminoacyl-tRNA editing activity Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0032553 ribonucleotide binding No
GO:0016874 ligase activity No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0009987 cellular process No
GO:0006520 cellular amino acid metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0052689 carboxylic ester hydrolase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1721
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1627 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5838
Ophiocordyceps camponoti-floridani Ophcf2|04846
Ophiocordyceps camponoti-rufipedis Ophun1|5394
Ophiocordyceps kimflemingae Ophio5|7372
Ophiocordyceps subramaniannii Hirsu2|1554

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1627
MQRHMARPRLVPRSVIGVSALPSRRFMQTLDLGALDSKWQQIWNEKLERRRIQHELRIRQLPSDSPADSRLMPCP
KFIVPMFPYPSGSLHMGHLRVYTVADVIARYRRIKGDNAALPIGWDAFGLPAENAARERSIDPREWTSANIAHMK
LQLQRINAEWDWTRELATCDPNYYAHTQRIFLALYKRGLIYQNEALVNWDPQDQTVLANEQVDANGCSWRSGAKV
VKKKLKQWFIRITAYKDALYDGLAELEKDGAWPSHVIEQQRHWMGKTTGYLVKFPLLAWGKPTSTALEAFVEQPA
YMSGAQFLALSPKHPLTRCMATTDLELQSFIDRIDAQDTEPHASYRLPSLQAKNPLAEDHLPHVPIFVYNPGHEE
GPGARMGVPGHNKDDQDFWAKNMPREPVRVAAVTPNHSKWDETNLQIVRELQRASMAKPFTRWRLRDWLISRQRY
WGTPIPIVHCKVCGAVPVPEENLPVKLPQVAPLHWERRKAGNPLESAAAWINTPCPTCTQPASRDTDTMDTFVDS
SWYYGRYADPDNPVLPWGPMASERSLPIDTYIGGVEHSILHLLYTRFIYKALANTPGLYPKFETMEAGMRAEPLQ
RLITQGMVHGKTYIDPSNGKFLVPAEVDLSDAQNPKVVATGAAAKVSFEKMSKSKHNGVDPTACIDKHGADATRA
HMLFQAPVNEVLNWDETNISGVTRWLHKVHDLVLNMAELPVSAQTPLDYLEHEFEKRTAGPMGLSWNESLSLWRM
AQNTIVLARDDYDKIYALNTVVSTLMKLSKSIQANTMAHDMIKREATSILVRLMAPITPAFSEECWRLLFPAAGS
VFEWASFPIPDGTLQMKHFQGVDQSCALHIDGRFAARLMLKRPKVQLSIEEMDEWTKDSVLATSVVLEKYSRDPI
DLKKAESVHVAKQGALINFVMPKTRRDDNPRKTKQ*
Coding >OphauG2|1627
ATGCAACGGCACATGGCTCGGCCGCGCCTCGTGCCACGCTCCGTCATTGGGGTGTCGGCGCTGCCCTCTCGCCGC
TTCATGCAGACACTCGACCTTGGAGCCCTCGACTCCAAGTGGCAGCAAATCTGGAACGAAAAGCTTGAGCGGCGC
CGGATACAGCACGAGCTACGCATCCGCCAGCTGCCCTCAGATAGCCCGGCCGACAGCCGCCTCATGCCCTGTCCC
AAGTTCATTGTGCCCATGTTCCCCTATCCCTCTGGCAGCCTGCACATGGGCCACTTGCGCGTCTACACCGTTGCC
GATGTCATTGCGCGCTACCGTCGAATCAAGGGAGACAACGCTGCGCTGCCAATTGGCTGGGATGCTTTTGGCTTG
CCGGCTGAAAACGCGGCCAGGGAGCGCAGTATTGACCCTCGCGAGTGGACAAGCGCAAACATTGCCCACATGAAG
CTGCAGCTGCAGCGCATCAACGCCGAATGGGATTGGACTCGCGAACTCGCCACGTGTGACCCCAACTACTACGCC
CATACCCAACGCATCTTCCTCGCCCTATATAAACGAGGACTCATATACCAGAACGAGGCTCTAGTCAACTGGGAC
CCCCAAGATCAGACAGTTTTGGCCAACGAGCAGGTAGACGCCAATGGCTGCTCATGGAGGTCTGGCGCCAAGGTG
GTCAAGAAGAAGCTGAAGCAGTGGTTTATTCGCATCACAGCGTATAAAGACGCTCTCTACGACGGCCTGGCAGAA
TTGGAAAAGGATGGGGCGTGGCCCAGCCACGTCATTGAACAACAGAGGCACTGGATGGGCAAGACGACGGGTTAC
TTGGTCAAGTTCCCTCTGTTGGCCTGGGGCAAGCCAACGTCAACGGCCCTCGAGGCGTTTGTGGAGCAGCCAGCA
TACATGTCTGGCGCCCAGTTCCTGGCGCTTTCGCCCAAGCATCCTCTCACCAGATGCATGGCCACAACAGACCTG
GAGCTGCAATCCTTTATTGACCGCATCGACGCCCAAGACACAGAGCCACATGCTTCTTATCGGCTGCCGTCCCTG
CAGGCAAAGAATCCTCTGGCTGAAGACCACCTCCCACATGTTCCCATATTTGTGTACAACCCTGGCCATGAAGAA
GGCCCTGGAGCCCGCATGGGCGTGCCGGGGCACAACAAAGACGACCAAGACTTTTGGGCCAAGAATATGCCCAGA
GAACCTGTGCGGGTGGCGGCCGTGACGCCAAATCACAGCAAATGGGACGAGACGAATTTGCAAATCGTCCGTGAG
CTCCAGAGGGCCAGCATGGCCAAGCCCTTCACCAGGTGGCGTCTGCGCGATTGGCTCATCAGCCGTCAACGCTAC
TGGGGCACGCCGATTCCAATTGTGCACTGCAAAGTGTGCGGTGCTGTCCCTGTGCCCGAAGAGAATCTGCCCGTC
AAGCTGCCGCAGGTGGCGCCCCTTCACTGGGAGAGGCGCAAGGCGGGCAACCCGCTCGAGTCGGCGGCAGCGTGG
ATCAACACTCCCTGCCCCACGTGCACGCAGCCGGCGTCGCGCGACACGGACACCATGGACACGTTTGTCGACTCG
AGCTGGTACTACGGCCGGTATGCCGACCCTGACAACCCCGTCCTGCCCTGGGGCCCCATGGCGTCGGAGAGGAGC
CTGCCCATTGACACGTACATCGGCGGCGTGGAACACTCCATCTTGCACCTGCTCTACACGCGCTTCATATACAAG
GCCTTGGCCAACACGCCCGGCTTGTACCCCAAGTTTGAGACCATGGAGGCAGGCATGAGGGCCGAGCCACTGCAA
CGCCTCATCACCCAAGGCATGGTGCACGGCAAGACGTATATCGACCCCAGCAATGGAAAGTTTCTCGTGCCGGCA
GAAGTCGACTTGTCTGATGCCCAAAACCCCAAGGTGGTGGCGACGGGCGCCGCGGCCAAGGTGTCGTTTGAGAAG
ATGTCCAAGTCGAAGCACAATGGCGTCGACCCGACGGCCTGCATCGACAAGCATGGCGCCGACGCGACGCGAGCC
CACATGCTCTTCCAGGCGCCCGTCAACGAGGTGCTCAACTGGGACGAGACCAATATCTCGGGCGTCACGCGCTGG
CTGCACAAGGTGCATGATTTGGTGCTCAACATGGCGGAGCTGCCCGTCAGCGCGCAGACGCCGCTCGACTACCTG
GAGCACGAGTTTGAAAAGCGCACAGCAGGGCCCATGGGCCTGAGCTGGAACGAGTCGCTGTCGCTGTGGCGCATG
GCGCAAAACACCATTGTGTTGGCGCGCGACGACTACGACAAGATTTATGCCCTCAACACCGTCGTGTCGACGCTC
ATGAAGCTGAGCAAGAGCATCCAGGCCAACACCATGGCGCACGACATGATTAAGCGCGAGGCTACAAGCATCCTG
GTGCGCCTCATGGCGCCCATTACGCCCGCCTTTTCTGAAGAGTGCTGGCGCCTCCTCTTCCCCGCGGCCGGGTCC
GTGTTTGAGTGGGCGTCGTTTCCCATTCCCGACGGCACGCTCCAGATGAAGCACTTCCAGGGCGTCGACCAGTCG
TGCGCGCTGCACATTGACGGCAGGTTTGCGGCGCGGCTCATGCTCAAGCGGCCCAAGGTGCAGCTGAGCATTGAG
GAGATGGATGAGTGGACCAAGGACTCGGTGCTGGCGACGAGCGTGGTGCTTGAAAAGTATAGCAGGGATCCGATT
GACTTGAAAAAGGCAGAGAGTGTCCACGTGGCCAAGCAGGGCGCGCTGATAAACTTTGTCATGCCCAAGACGAGA
AGAGACGACAACCCAAGGAAGACGAAGCAATGA
Transcript >OphauG2|1627
ATGCAACGGCACATGGCTCGGCCGCGCCTCGTGCCACGCTCCGTCATTGGGGTGTCGGCGCTGCCCTCTCGCCGC
TTCATGCAGACACTCGACCTTGGAGCCCTCGACTCCAAGTGGCAGCAAATCTGGAACGAAAAGCTTGAGCGGCGC
CGGATACAGCACGAGCTACGCATCCGCCAGCTGCCCTCAGATAGCCCGGCCGACAGCCGCCTCATGCCCTGTCCC
AAGTTCATTGTGCCCATGTTCCCCTATCCCTCTGGCAGCCTGCACATGGGCCACTTGCGCGTCTACACCGTTGCC
GATGTCATTGCGCGCTACCGTCGAATCAAGGGAGACAACGCTGCGCTGCCAATTGGCTGGGATGCTTTTGGCTTG
CCGGCTGAAAACGCGGCCAGGGAGCGCAGTATTGACCCTCGCGAGTGGACAAGCGCAAACATTGCCCACATGAAG
CTGCAGCTGCAGCGCATCAACGCCGAATGGGATTGGACTCGCGAACTCGCCACGTGTGACCCCAACTACTACGCC
CATACCCAACGCATCTTCCTCGCCCTATATAAACGAGGACTCATATACCAGAACGAGGCTCTAGTCAACTGGGAC
CCCCAAGATCAGACAGTTTTGGCCAACGAGCAGGTAGACGCCAATGGCTGCTCATGGAGGTCTGGCGCCAAGGTG
GTCAAGAAGAAGCTGAAGCAGTGGTTTATTCGCATCACAGCGTATAAAGACGCTCTCTACGACGGCCTGGCAGAA
TTGGAAAAGGATGGGGCGTGGCCCAGCCACGTCATTGAACAACAGAGGCACTGGATGGGCAAGACGACGGGTTAC
TTGGTCAAGTTCCCTCTGTTGGCCTGGGGCAAGCCAACGTCAACGGCCCTCGAGGCGTTTGTGGAGCAGCCAGCA
TACATGTCTGGCGCCCAGTTCCTGGCGCTTTCGCCCAAGCATCCTCTCACCAGATGCATGGCCACAACAGACCTG
GAGCTGCAATCCTTTATTGACCGCATCGACGCCCAAGACACAGAGCCACATGCTTCTTATCGGCTGCCGTCCCTG
CAGGCAAAGAATCCTCTGGCTGAAGACCACCTCCCACATGTTCCCATATTTGTGTACAACCCTGGCCATGAAGAA
GGCCCTGGAGCCCGCATGGGCGTGCCGGGGCACAACAAAGACGACCAAGACTTTTGGGCCAAGAATATGCCCAGA
GAACCTGTGCGGGTGGCGGCCGTGACGCCAAATCACAGCAAATGGGACGAGACGAATTTGCAAATCGTCCGTGAG
CTCCAGAGGGCCAGCATGGCCAAGCCCTTCACCAGGTGGCGTCTGCGCGATTGGCTCATCAGCCGTCAACGCTAC
TGGGGCACGCCGATTCCAATTGTGCACTGCAAAGTGTGCGGTGCTGTCCCTGTGCCCGAAGAGAATCTGCCCGTC
AAGCTGCCGCAGGTGGCGCCCCTTCACTGGGAGAGGCGCAAGGCGGGCAACCCGCTCGAGTCGGCGGCAGCGTGG
ATCAACACTCCCTGCCCCACGTGCACGCAGCCGGCGTCGCGCGACACGGACACCATGGACACGTTTGTCGACTCG
AGCTGGTACTACGGCCGGTATGCCGACCCTGACAACCCCGTCCTGCCCTGGGGCCCCATGGCGTCGGAGAGGAGC
CTGCCCATTGACACGTACATCGGCGGCGTGGAACACTCCATCTTGCACCTGCTCTACACGCGCTTCATATACAAG
GCCTTGGCCAACACGCCCGGCTTGTACCCCAAGTTTGAGACCATGGAGGCAGGCATGAGGGCCGAGCCACTGCAA
CGCCTCATCACCCAAGGCATGGTGCACGGCAAGACGTATATCGACCCCAGCAATGGAAAGTTTCTCGTGCCGGCA
GAAGTCGACTTGTCTGATGCCCAAAACCCCAAGGTGGTGGCGACGGGCGCCGCGGCCAAGGTGTCGTTTGAGAAG
ATGTCCAAGTCGAAGCACAATGGCGTCGACCCGACGGCCTGCATCGACAAGCATGGCGCCGACGCGACGCGAGCC
CACATGCTCTTCCAGGCGCCCGTCAACGAGGTGCTCAACTGGGACGAGACCAATATCTCGGGCGTCACGCGCTGG
CTGCACAAGGTGCATGATTTGGTGCTCAACATGGCGGAGCTGCCCGTCAGCGCGCAGACGCCGCTCGACTACCTG
GAGCACGAGTTTGAAAAGCGCACAGCAGGGCCCATGGGCCTGAGCTGGAACGAGTCGCTGTCGCTGTGGCGCATG
GCGCAAAACACCATTGTGTTGGCGCGCGACGACTACGACAAGATTTATGCCCTCAACACCGTCGTGTCGACGCTC
ATGAAGCTGAGCAAGAGCATCCAGGCCAACACCATGGCGCACGACATGATTAAGCGCGAGGCTACAAGCATCCTG
GTGCGCCTCATGGCGCCCATTACGCCCGCCTTTTCTGAAGAGTGCTGGCGCCTCCTCTTCCCCGCGGCCGGGTCC
GTGTTTGAGTGGGCGTCGTTTCCCATTCCCGACGGCACGCTCCAGATGAAGCACTTCCAGGGCGTCGACCAGTCG
TGCGCGCTGCACATTGACGGCAGGTTTGCGGCGCGGCTCATGCTCAAGCGGCCCAAGGTGCAGCTGAGCATTGAG
GAGATGGATGAGTGGACCAAGGACTCGGTGCTGGCGACGAGCGTGGTGCTTGAAAAGTATAGCAGGGATCCGATT
GACTTGAAAAAGGCAGAGAGTGTCCACGTGGCCAAGCAGGGCGCGCTGATAAACTTTGTCATGCCCAAGACGAGA
AGAGACGACAACCCAAGGAAGACGAAGCAATGA
Gene >OphauG2|1627
ATGCAACGGCACATGGCTCGGCCGCGCCTCGTGCCACGCTCCGTCATTGGGGTGTCGGCGCTGCCCTCTCGCCGC
TTCATGCAGACACTCGACCTTGGAGCCCTCGACTCCAAGTGGCAGCAAATCTGGAACGAAAAGCTTGAGCGGCGC
CGGATACAGCACGAGCTACGCATCCGCCAGCTGCCCTCAGATAGCCCGGCCGACAGCCGCCTCATGCCCTGTCCC
AAGTTCATTGTGCCCATGTTCCCCTATCCCTCTGGCAGCCTGCACATGGGCCACTTGCGCGTCTACACCGTTGCC
GATGTCATTGCGCGCTACCGTCGAATCAAGGGAGACAACGCTGCGCTGCCAATTGGCTGGGATGCTTTTGGCTTG
CCGGCTGAAAACGCGGCCAGGGAGCGCAGTATTGACCCTCGCGAGTGGACAAGCGCAAACATTGCCCACATGAAG
CTGCAGCTGCAGCGCATCAACGCCGAATGGGATTGGACTCGCGTGAGTCCTTGATAGCTCCTTGTTCCGTCTGTC
TTGGAGCCAGAGCTGATGCTCGGCTGGCGCAGGAACTCGCCACGTGTGACCCCAACTACTACGCCCATACCCAAC
GCATCTTCCTCGCCCTATATAAACGAGGACTCATATACCAGAACGAGGCTCTAGTCAACTGGGACCCCCAAGATC
AGACAGTTTTGGCCAACGAGCAGGTAGACGCCAATGGCTGCTCATGGAGGTCTGGCGCCAAGGTGGTCAAGAAGA
AGCTGAAGCAGTGGTTTATTCGCATCACAGCGTATAAAGACGCTCTCTACGACGGCCTGGCAGAATTGGAAAAGG
ATGGGGCGTGGCCCAGCCACGTCATTGAACAACAGAGGCACTGGATGGGCAAGACGACGGGTTACTTGGTCAAGT
TCCCTCTGTTGGCCTGGGGCAAGCCAACGTCAACGGCCCTCGAGGCGTTTGTGGAGCAGCCAGCATACATGTCTG
GCGCCCAGTTCCTGGCGCTTTCGCCCAAGCATCCTCTCACCAGATGCATGGCCACAACAGACCTGGAGCTGCAAT
CCTTTATTGACCGCATCGACGCCCAAGACACAGAGCCACATGCTTCTTATCGGCTGCCGTCCCTGCAGGCAAAGA
ATCCTCTGGCTGAAGACCACCTCCCACATGTTCCCATATTTGTGTACAACCCTGGCCATGAAGAAGGCCCTGGAG
CCCGCATGGGCGTGCCGGGGCACAACAAAGACGACCAAGACTTTTGGGCCAAGAATATGCCCAGAGAACCTGTGC
GGGTGGCGGCCGTGACGCCAAATCACAGCAAATGGGACGAGACGAATTTGCAAATCGTCCGTGAGCTCCAGAGGG
CCAGCATGGCCAAGCCCTTCACCAGGTGGCGTCTGCGCGATTGGCTCATCAGCCGTCAACGCTACTGGGGCACGC
CGATTCCAATTGTGCACTGCAAAGTGTGCGGTGCTGTCCCTGTGCCCGAAGAGAATCTGCCCGTCAAGCTGCCGC
AGGTGGCGCCCCTTCACTGGGAGAGGCGCAAGGCGGGCAACCCGCTCGAGTCGGCGGCAGCGTGGATCAACACTC
CCTGCCCCACGTGCACGCAGCCGGCGTCGCGCGACACGGACACCATGGACACGTTTGTCGACTCGAGCTGGTACT
ACGGCCGGTATGCCGACCCTGACAACCCCGTCCTGCCCTGGGGCCCCATGGCGTCGGAGAGGAGCCTGCCCATTG
ACACGTACATCGGCGGCGTGGAACACTCCATCTTGCACCTGCTCTACACGCGCTTCATATACAAGGCCTTGGCCA
ACACGCCCGGCTTGTACCCCAAGTTTGAGACCATGGAGGCAGGCATGAGGGCCGAGCCACTGCAACGCCTCATCA
CCCAAGGCATGGTGCACGGCAAGACGTATATCGACCCCAGCAATGGAAAGTTTCTCGTGCCGGCAGAAGTCGACT
TGTCTGATGCCCAAAACCCCAAGGTGGTGGCGACGGGCGCCGCGGCCAAGGTGTCGTTTGAGAAGATGTCCAAGT
CGAAGCACAATGGCGTCGACCCGACGGCCTGCATCGACAAGCATGGCGCCGACGCGACGCGAGCCCACATGCTCT
TCCAGGCGCCCGTCAACGAGGTGCTCAACTGGGACGAGACCAATATCTCGGGCGTCACGCGCTGGCTGCACAAGG
TGCATGATTTGGTGCTCAACATGGCGGAGCTGCCCGTCAGCGCGCAGACGCCGCTCGACTACCTGGAGCACGAGT
TTGAAAAGCGCACAGCAGGGCCCATGGGCCTGAGCTGGAACGAGTCGCTGTCGCTGTGGCGCATGGCGCAAAACA
CCATTGTGTTGGCGCGCGACGACTACGACAAGATTTATGCCCTCAACACCGTCGTGTCGACGCTCATGAAGCTGA
GCAAGAGCATCCAGGCCAACACCATGGCGCACGACATGATTAAGCGCGAGGCTACAAGCATCCTGGTGCGCCTCA
TGGCGCCCATTACGCCCGCCTTTTCTGAAGAGTGCTGGCGCCTCCTCTTCCCCGCGGCCGGGTCCGTGTTTGAGT
GGGCGTCGTTTCCCATTCCCGACGGCACGCTCCAGATGAAGCACTTCCAGGGCGTCGACCAGTCGTGCGCGCTGC
ACATTGACGGCAGGTTTGCGGCGCGGCTCATGCTCAAGCGGCCCAAGGTGCAGCTGAGCATTGAGGAGATGGATG
AGTGGACCAAGGACTCGGTGCTGGCGACGAGCGTGGTGCTTGAAAAGTATAGCAGGGATCCGATTGACTTGAAAA
AGGCAGAGAGTGTCCACGTGGCCAAGCAGGGCGCGCTGATAAACTTTGTCATGCCCAAGACGAGAAGAGACGACA
ACCCAAGGAAGACGAAGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail