Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1607
Gene name
LocationContig_15:20251..21394
Strand+
Gene length (bp)1143
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09531 Ndc1_Nup Nucleoporin protein Ndc1-Nup 2.3E-95 2 341

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S235|NDC1_CHATD Nucleoporin NDC1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NDC1 PE=3 SV=1 5 344 8.0E-65
sp|O13961|NDC1_SCHPO Nuclear envelope protein ndc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut11 PE=2 SV=2 9 343 1.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1607
MFLNFVWFIANLTFSVYMVQAPLRDAEPLTSRSKHPNDVLLNGLMNKKVSIKAFATWELALIAQKFPDRRRAIFD
DIDRKGGAMWAQIYDVCTQILKSIEQHIEAYEKPAAAVATAPMPAAPKQRRCPPPRQDTGLYHNKQNSGLIGGME
KTLAELSRSPGATPMASWSPLAQKTWNNAKDRMLSKRQQEALSPENIKSEAERWIGRVMDLGWVAALVRQDFDRR
FSAAVFGATLAEPSLYMHAAQAMCQMAIHSLDEDDYGNVQRDVATIIRILMSVIEKVEAFKAQMPTHWTDPTDSK
ATPTVDTVMDVFRMELRQVVDRFEPYRFDLGLSAVEIRKARILAPQPHEGDALRGRDQGD*
Coding >OphauG2|1607
ATGTTTTTGAATTTCGTCTGGTTTATTGCGAACCTGACCTTCTCGGTCTACATGGTACAGGCCCCATTGAGGGAT
GCAGAGCCTCTAACATCTAGATCGAAGCACCCTAATGACGTTTTACTCAATGGTCTCATGAACAAGAAAGTGTCC
ATCAAGGCTTTTGCCACGTGGGAGCTGGCACTTATTGCCCAAAAGTTTCCGGATCGCAGAAGGGCCATATTCGAC
GACATTGATCGTAAAGGCGGTGCCATGTGGGCACAAATATACGATGTCTGCACACAAATTCTCAAGAGCATCGAA
CAGCACATCGAGGCATACGAAAAGCCGGCTGCCGCGGTGGCTACCGCTCCTATGCCAGCAGCACCCAAGCAAAGG
AGGTGCCCGCCGCCGCGCCAGGACACAGGCCTTTACCATAACAAGCAGAATTCAGGACTGATTGGTGGAATGGAA
AAGACTTTGGCAGAATTGTCTCGGTCACCAGGCGCGACTCCAATGGCGAGCTGGAGCCCGTTGGCGCAAAAGACT
TGGAACAACGCCAAGGACCGCATGCTTAGCAAAAGGCAGCAAGAAGCACTATCACCCGAAAATATCAAGAGTGAG
GCGGAAAGGTGGATAGGCAGAGTGATGGATTTGGGATGGGTAGCAGCCCTGGTGCGCCAAGACTTTGATAGACGC
TTTTCTGCCGCTGTCTTTGGGGCGACGCTGGCAGAGCCATCGCTGTACATGCACGCAGCTCAAGCAATGTGCCAG
ATGGCTATTCACAGCCTGGACGAGGACGACTATGGCAATGTACAGCGCGACGTTGCGACCATTATCCGCATCTTG
ATGAGCGTGATTGAAAAAGTGGAGGCCTTCAAGGCGCAAATGCCGACGCATTGGACTGACCCGACTGACAGCAAA
GCGACTCCGACGGTGGACACTGTCATGGATGTGTTTAGGATGGAGTTGCGCCAAGTGGTGGATAGGTTTGAGCCC
TATAGGTTCGACCTGGGGCTTTCGGCTGTTGAGATTCGGAAGGCTAGAATCCTGGCACCGCAGCCGCACGAAGGC
GACGCCTTGCGAGGAAGAGATCAAGGGGACTAA
Transcript >OphauG2|1607
ATGTTTTTGAATTTCGTCTGGTTTATTGCGAACCTGACCTTCTCGGTCTACATGGTACAGGCCCCATTGAGGGAT
GCAGAGCCTCTAACATCTAGATCGAAGCACCCTAATGACGTTTTACTCAATGGTCTCATGAACAAGAAAGTGTCC
ATCAAGGCTTTTGCCACGTGGGAGCTGGCACTTATTGCCCAAAAGTTTCCGGATCGCAGAAGGGCCATATTCGAC
GACATTGATCGTAAAGGCGGTGCCATGTGGGCACAAATATACGATGTCTGCACACAAATTCTCAAGAGCATCGAA
CAGCACATCGAGGCATACGAAAAGCCGGCTGCCGCGGTGGCTACCGCTCCTATGCCAGCAGCACCCAAGCAAAGG
AGGTGCCCGCCGCCGCGCCAGGACACAGGCCTTTACCATAACAAGCAGAATTCAGGACTGATTGGTGGAATGGAA
AAGACTTTGGCAGAATTGTCTCGGTCACCAGGCGCGACTCCAATGGCGAGCTGGAGCCCGTTGGCGCAAAAGACT
TGGAACAACGCCAAGGACCGCATGCTTAGCAAAAGGCAGCAAGAAGCACTATCACCCGAAAATATCAAGAGTGAG
GCGGAAAGGTGGATAGGCAGAGTGATGGATTTGGGATGGGTAGCAGCCCTGGTGCGCCAAGACTTTGATAGACGC
TTTTCTGCCGCTGTCTTTGGGGCGACGCTGGCAGAGCCATCGCTGTACATGCACGCAGCTCAAGCAATGTGCCAG
ATGGCTATTCACAGCCTGGACGAGGACGACTATGGCAATGTACAGCGCGACGTTGCGACCATTATCCGCATCTTG
ATGAGCGTGATTGAAAAAGTGGAGGCCTTCAAGGCGCAAATGCCGACGCATTGGACTGACCCGACTGACAGCAAA
GCGACTCCGACGGTGGACACTGTCATGGATGTGTTTAGGATGGAGTTGCGCCAAGTGGTGGATAGGTTTGAGCCC
TATAGGTTCGACCTGGGGCTTTCGGCTGTTGAGATTCGGAAGGCTAGAATCCTGGCACCGCAGCCGCACGAAGGC
GACGCCTTGCGAGGAAGAGATCAAGGGGACTAA
Gene >OphauG2|1607
ATGTTTTTGAATTTCGTCTGGTTTATTGCGAACCTGACCTTCTCGGTCTACATGGTACAGGCCCCATTGAGGGAT
GCAGAGCCTCTAACATCTAGATCGAAGCACCCTAATGACGTTTTACTCAATGGTCTCATGAACAAGAAAGTGTCC
ATCAAGGTAGGTGCTTTCCAATGATGCCATGATTGGTGCTTTGAAAAAACACTAACCTGAGAGCAGGCTTTTGCC
ACGTGGGAGCTGGCACTTATTGCCCAAAAGTTTCCGGATCGCAGAAGGGCCATATTCGACGACATTGATCGTAAA
GGCGGTGCCATGTGGGCACAAATATACGATGTCTGCACACAAATTCTCAAGAGCATCGAACAGCACATCGAGGCA
TACGAAAAGCCGGCTGCCGCGGTGGCTACCGCTCCTATGCCAGCAGCACCCAAGCAAAGGAGGTGCCCGCCGCCG
CGCCAGGACACAGGCCTTTACCATAACAAGCAGAATTCAGGACTGATTGGTGGAATGGAAAAGACTTTGGCAGAA
TTGTCTCGGTCACCAGGCGCGACTCCAATGGCGAGCTGGAGCCCGTTGGCGCAAAAGACTTGGAACAACGCCAAG
GACCGCATGCTTAGCAAAAGGCAGCAAGAAGCACTATCACCCGAAAATATCAAGAGTGAGGCGGAAAGGTGGATA
GGCAGAGTGATGGATTTGGGATGGGTAGCAGCCCTGGTGCGCCAAGACTTTGATAGACGCTTTTCTGCCGCTGTC
TTTGGGGCGACGCTGGCAGAGCCATCGCTGTACATGCACGCAGCTCAAGCAATGTGCCAGATGGCTATTCACAGC
CTGGACGAGGACGACTATGGCAATGTACAGCGCGACGTTGCGACCATTATCCGCATCTTGATGAGCGTGATTGAA
AAAGTGGAGGCCTTCAAGGCGCAAATGCCGACGCATTGGACTGACCCGACTGACAGCAAAGCGACTCCGACGGTG
GACACTGTCATGGATGTGTTTAGGATGGAGTTGCGCCAAGTGGTGGATAGGTTTGAGCCCTATAGGTTCGACCTG
GGGCTTTCGGCTGTTGAGATTCGGAAGGCTAGAATCCTGGCACCGCAGCCGCACGAAGGCGACGCCTTGCGAGGA
AGAGATCAAGGGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail