Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1599
Gene name
LocationContig_15:49..1540
Strand-
Gene length (bp)1491
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09350 DJC28_CD DnaJ homologue, subfamily C, member 28, conserved domain 5.1E-20 219 287

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4860
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1599 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6729
Ophiocordyceps camponoti-floridani Ophcf2|01833
Ophiocordyceps kimflemingae Ophio5|3661
Ophiocordyceps subramaniannii Hirsu2|10984

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1599
MLCRCCLRASKRIGVGTFSTRAIDGDATPYSAKSEKKKDNAPQQNGETSTLQAKQGALARRLEEATEHVLLTEGS
SGRQAVQDAGFSEEIKEKLLNRFSAADLGKEGPEVLQEVGSTTSADAASRQAWKGGEGAKDAVLRMIDDARRPSS
PAAQTKWKTQSPGQRIASARDQVSMYAGAGLKGLSKEEKLEMKQQLKERYHPVARSMPVPVSESGLAAMANRRID
EAIARGQFQKLPRGKRLENDARKNSPYIDTTQFLMNRIIQRQDIVPPWIEKQQELLKSTRVFRSRLRSDWRRHMA
RMVAAEGGSLQEQIKRAKDYAVAERRYNSHRQSKVVSSDATMGNEATSTLLETQTVQNKDDESHVHLEAGDEEQT
PCLFRDAAWIEAERAYLQVSIDNLNSMTRSYNLMAPDVAKKGYVDLQRELSACWADVAPTIADEIQQRATGRASP
PPRMPLTGASVMAMLKHSSDAVKIHVEAEEKAYGLRQWWRDLWQKR*
Coding >OphauG2|1599
ATGCTCTGCCGATGCTGTCTCAGAGCCTCCAAGCGCATTGGCGTTGGCACCTTTTCGACTCGAGCCATTGATGGA
GACGCAACCCCATATTCGGCCAAGTCTGAGAAAAAGAAAGACAACGCTCCTCAACAAAACGGCGAGACGTCTACA
TTACAGGCTAAGCAAGGGGCCTTGGCTCGCCGACTAGAAGAGGCTACTGAGCATGTCCTCTTGACAGAGGGCTCT
TCAGGCAGACAGGCTGTGCAAGACGCGGGCTTTTCGGAAGAGATCAAGGAGAAGCTTTTAAATAGGTTTTCCGCT
GCAGACCTGGGCAAGGAGGGCCCAGAGGTGCTACAGGAGGTTGGTTCGACGACGAGCGCCGATGCAGCCTCTCGA
CAGGCTTGGAAGGGTGGTGAGGGCGCAAAGGATGCGGTGCTTCGAATGATTGACGATGCGAGGAGGCCCTCTAGC
CCTGCAGCGCAGACGAAATGGAAGACGCAAAGTCCAGGGCAGAGAATCGCCAGCGCACGGGACCAGGTGTCCATG
TATGCTGGCGCCGGTCTCAAGGGCCTCAGCAAGGAGGAGAAACTGGAGATGAAGCAGCAGCTCAAGGAGCGTTAT
CATCCGGTGGCGAGGTCCATGCCCGTGCCGGTCTCCGAATCCGGGCTGGCTGCCATGGCGAACCGTCGCATCGAC
GAAGCCATTGCTCGGGGCCAGTTCCAGAAGCTCCCCCGCGGCAAGAGGCTGGAGAATGATGCCCGTAAAAATAGC
CCGTATATCGACACAACACAGTTCTTGATGAATAGGATTATTCAGCGGCAAGACATTGTGCCGCCATGGATTGAG
AAGCAGCAGGAACTGCTAAAGAGTACGCGTGTCTTTCGCTCGAGGTTACGCAGTGACTGGAGGCGCCACATGGCA
AGAATGGTGGCAGCCGAGGGAGGTTCTCTCCAGGAGCAAATCAAGAGAGCCAAAGACTATGCAGTGGCCGAGCGA
CGTTACAATTCGCATCGTCAGTCCAAGGTGGTGTCTAGTGATGCTACCATGGGCAACGAAGCCACGAGCACGCTG
CTGGAGACTCAGACTGTGCAAAACAAAGATGACGAGAGCCACGTGCATCTAGAGGCTGGAGACGAGGAACAGACG
CCATGTTTATTCCGTGATGCGGCGTGGATAGAGGCAGAAAGGGCATATTTGCAGGTGTCTATTGACAATCTCAAC
AGCATGACACGGAGCTATAATCTCATGGCGCCTGATGTGGCCAAGAAGGGCTATGTTGATTTACAGAGAGAGCTA
TCGGCTTGTTGGGCAGACGTGGCGCCAACCATAGCTGATGAAATCCAGCAGAGGGCAACAGGGAGAGCTTCGCCG
CCGCCTCGAATGCCTTTAACCGGAGCAAGCGTCATGGCCATGTTAAAGCACAGTAGCGATGCTGTCAAGATACAC
GTGGAAGCAGAGGAGAAGGCGTATGGCCTGCGGCAATGGTGGCGAGATTTATGGCAGAAGCGGTAA
Transcript >OphauG2|1599
ATGCTCTGCCGATGCTGTCTCAGAGCCTCCAAGCGCATTGGCGTTGGCACCTTTTCGACTCGAGCCATTGATGGA
GACGCAACCCCATATTCGGCCAAGTCTGAGAAAAAGAAAGACAACGCTCCTCAACAAAACGGCGAGACGTCTACA
TTACAGGCTAAGCAAGGGGCCTTGGCTCGCCGACTAGAAGAGGCTACTGAGCATGTCCTCTTGACAGAGGGCTCT
TCAGGCAGACAGGCTGTGCAAGACGCGGGCTTTTCGGAAGAGATCAAGGAGAAGCTTTTAAATAGGTTTTCCGCT
GCAGACCTGGGCAAGGAGGGCCCAGAGGTGCTACAGGAGGTTGGTTCGACGACGAGCGCCGATGCAGCCTCTCGA
CAGGCTTGGAAGGGTGGTGAGGGCGCAAAGGATGCGGTGCTTCGAATGATTGACGATGCGAGGAGGCCCTCTAGC
CCTGCAGCGCAGACGAAATGGAAGACGCAAAGTCCAGGGCAGAGAATCGCCAGCGCACGGGACCAGGTGTCCATG
TATGCTGGCGCCGGTCTCAAGGGCCTCAGCAAGGAGGAGAAACTGGAGATGAAGCAGCAGCTCAAGGAGCGTTAT
CATCCGGTGGCGAGGTCCATGCCCGTGCCGGTCTCCGAATCCGGGCTGGCTGCCATGGCGAACCGTCGCATCGAC
GAAGCCATTGCTCGGGGCCAGTTCCAGAAGCTCCCCCGCGGCAAGAGGCTGGAGAATGATGCCCGTAAAAATAGC
CCGTATATCGACACAACACAGTTCTTGATGAATAGGATTATTCAGCGGCAAGACATTGTGCCGCCATGGATTGAG
AAGCAGCAGGAACTGCTAAAGAGTACGCGTGTCTTTCGCTCGAGGTTACGCAGTGACTGGAGGCGCCACATGGCA
AGAATGGTGGCAGCCGAGGGAGGTTCTCTCCAGGAGCAAATCAAGAGAGCCAAAGACTATGCAGTGGCCGAGCGA
CGTTACAATTCGCATCGTCAGTCCAAGGTGGTGTCTAGTGATGCTACCATGGGCAACGAAGCCACGAGCACGCTG
CTGGAGACTCAGACTGTGCAAAACAAAGATGACGAGAGCCACGTGCATCTAGAGGCTGGAGACGAGGAACAGACG
CCATGTTTATTCCGTGATGCGGCGTGGATAGAGGCAGAAAGGGCATATTTGCAGGTGTCTATTGACAATCTCAAC
AGCATGACACGGAGCTATAATCTCATGGCGCCTGATGTGGCCAAGAAGGGCTATGTTGATTTACAGAGAGAGCTA
TCGGCTTGTTGGGCAGACGTGGCGCCAACCATAGCTGATGAAATCCAGCAGAGGGCAACAGGGAGAGCTTCGCCG
CCGCCTCGAATGCCTTTAACCGGAGCAAGCGTCATGGCCATGTTAAAGCACAGTAGCGATGCTGTCAAGATACAC
GTGGAAGCAGAGGAGAAGGCGTATGGCCTGCGGCAATGGTGGCGAGATTTATGGCAGAAGCGGTAA
Gene >OphauG2|1599
ATGCTCTGCCGATGCTGTCTCAGAGCCTCCAAGCGCATTGGCGTTGGCACCTTTTCGACTCGAGCCATTGATGGA
GACGCAACCCCATATTCGGCCAAGTCTGAGAAAAAGAAAGACAACGCTCCTCAACAAAACGGCGAGACGTCTACA
TTACAGGCTAAGCAAGGGGCCTTGGCTCGCCGACTAGAAGAGGCTACTGAGCATGTCCTCTTGACAGAGGGCTCT
TCAGGCAGACAGGCTGTGCAAGACGCGGGCTTTTCGGAAGAGATCAAGGAGAAGCTTTTAAATAGGTTTTCCGCT
GCAGACCTGGGCAAGGAGGGCCCAGAGGTGCTACAGGAGGTTGGTTCGACGACGAGCGCCGATGCAGCCTCTCGA
CAGGCTTGGAAGGGTGGTGAGGGCGCAAAGGATGCGGTGCTTCGAATGATTGACGATGCGAGGAGGCCCTCTAGC
CCTGCAGCGCAGACGAAATGGAAGACGCAAAGTCCAGGGCAGAGAATCGCCAGCGCACGGGACCAGGTGTCCATG
TATGCTGGCGCCGGTCTCAAGGGCCTCAGCAAGGAGGAGAAACTGGAGATGAAGCAGCAGCTCAAGGAGCGTTAT
CATCCGGTGGCGAGGTCCATGCCCGTGCCGGTCTCCGAATCCGGGCTGGCTGCCATGGCGAACCGTCGCATCGAC
GAAGCCATTGCTCGGGGCCAGTTCCAGAAGCTCCCCCGCGGCAAGAGGCTGGAGAATGATGCCCGTAAAAATAGC
CCGTATATCGACACAACACAGTTCTTGATGAATAGGATTATTCAGCGGCAAGACATTGTGCCGCCATGGATTGAG
AAGCAGCAGGAACTGCTAAAGAGTACGCGTGTCTTTCGCTCGAGGTTACGCAGTGACTGGAGGCGCCACATGGCA
AGAATGGTGGCAGCCGAGGGAGGTTCTCTCCAGGAGCAAATCAAGAGAGCCAAAGACTATGCAGTGGCCGAGCGA
CGTTACAATTCGCATCGTCAGTCCAAGGTGGTGTCTAGTGATGCTACCATGGGCAACGAAGCCACGAGCACGCTG
CTGGAGACTCAGACTGTGCAAAACAAAGATGACGAGAGCCACGTGCATCTAGAGGCTGGAGACGAGGAACAGACG
CCATGTTTATTCCGTGATGCGGCGTGGATAGAGGCAGAAAGGGCATATTTGCAGGTGTCTATTGACAATCTCAAC
AGCATGACACGGAGCTATAATCTCATGGCGCCTGATGTGGCCAAGAAGGGCTATGTTGATTTACAGAGAGAGCTA
TCGGCTTGTTGGGCAGACGTGGCGCCAACCATAGCTGATGAAATCCAGCAGAGGGCAACAGGGAGAGCTTCGCCG
CCGCCTCGAATGCCTTTAACCGGAGCAAGCGTCATGGCCATGTTAAAGCACAGTAGCGATGCTGTCAAGATACAC
GTGGAAGCAGAGGAGAAGGCGTATGGCCTGCGGCAATGGTGGCGAGATTTATGGCAGAAGCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail