Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1592
Gene name
LocationContig_1490:1665..3414
Strand+
Gene length (bp)1749
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 8.5E-74 49 404
PF07976 Phe_hydrox_dim Phenol hydroxylase, C-terminal dimerisation domain 4.1E-18 430 513

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15245|PH2M_TRICU Phenol 2-monooxygenase OS=Trichosporon cutaneum PE=1 SV=3 50 447 2.0E-68
sp|Q6SSJ6|MOBA_COMTE 3-hydroxybenzoate 4-monooxygenase OS=Comamonas testosteroni GN=mobA PE=1 SV=1 47 508 5.0E-68
sp|O07561|YHJG_BACSU Uncharacterized aromatic compound monooxygenase YhjG OS=Bacillus subtilis (strain 168) GN=yhjG PE=3 SV=1 51 402 1.0E-28
sp|Q58PK7|OTCC_STRRM Anhydrotetracycline monooxygenase OS=Streptomyces rimosus GN=otcC PE=1 SV=1 52 398 3.0E-23
sp|P42535|PCPB_SPHCR Pentachlorophenol 4-monooxygenase OS=Sphingobium chlorophenolicum GN=pcpB PE=1 SV=4 44 463 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15245|PH2M_TRICU Phenol 2-monooxygenase OS=Trichosporon cutaneum PE=1 SV=3 50 447 2.0E-68
sp|Q6SSJ6|MOBA_COMTE 3-hydroxybenzoate 4-monooxygenase OS=Comamonas testosteroni GN=mobA PE=1 SV=1 47 508 5.0E-68
sp|O07561|YHJG_BACSU Uncharacterized aromatic compound monooxygenase YhjG OS=Bacillus subtilis (strain 168) GN=yhjG PE=3 SV=1 51 402 1.0E-28
sp|Q58PK7|OTCC_STRRM Anhydrotetracycline monooxygenase OS=Streptomyces rimosus GN=otcC PE=1 SV=1 52 398 3.0E-23
sp|P42535|PCPB_SPHCR Pentachlorophenol 4-monooxygenase OS=Sphingobium chlorophenolicum GN=pcpB PE=1 SV=4 44 463 2.0E-22
sp|A0R1T4|MHPA_MYCS2 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mhpA PE=3 SV=2 47 404 2.0E-18
sp|Q54530|DNRF_STREF Aklavinone 12-hydroxylase RdmE OS=Streptomyces purpurascens GN=rdmE PE=1 SV=1 49 402 3.0E-18
sp|Q8KN28|TFDB_DELAC 2,4-dichlorophenol 6-monooxygenase OS=Delftia acidovorans GN=tfdB PE=1 SV=3 49 402 3.0E-18
sp|B7NK08|MHPA_ECO7I 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mhpA PE=3 SV=1 50 429 1.0E-17
sp|B1LIN2|MHPA_ECOSM 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mhpA PE=3 SV=1 50 429 1.0E-17
sp|B7N8Q4|MHPA_ECOLU 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mhpA PE=3 SV=1 50 429 1.0E-17
sp|P39888|TCMG_STRGA Tetracenomycin polyketide synthesis hydroxylase TcmG OS=Streptomyces glaucescens GN=tcmG PE=3 SV=1 49 398 1.0E-17
sp|Q476N1|MHPA_CUPPJ 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mhpA PE=3 SV=1 46 430 1.0E-17
sp|B7MPB4|MHPA_ECO81 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O81 (strain ED1a) GN=mhpA PE=3 SV=1 50 429 3.0E-17
sp|Q3Z585|MHPA_SHISS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Shigella sonnei (strain Ss046) GN=mhpA PE=3 SV=1 50 429 5.0E-17
sp|B6HZX3|MHPA_ECOSE 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain SE11) GN=mhpA PE=3 SV=1 50 429 5.0E-17
sp|A7ZWZ4|MHPA_ECOHS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O9:H4 (strain HS) GN=mhpA PE=3 SV=1 50 429 5.0E-17
sp|A7ZI94|MHPA_ECO24 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mhpA PE=3 SV=1 50 429 5.0E-17
sp|P77397|MHPA_ECOLI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain K12) GN=mhpA PE=1 SV=1 50 429 9.0E-17
sp|B1XBJ4|MHPA_ECODH 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain K12 / DH10B) GN=mhpA PE=3 SV=1 50 429 9.0E-17
sp|B7L503|MHPA_ECO55 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli (strain 55989 / EAEC) GN=mhpA PE=3 SV=1 50 429 1.0E-16
sp|B5Z2Q2|MHPA_ECO5E 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mhpA PE=3 SV=1 50 429 1.0E-16
sp|Q8X680|MHPA_ECO57 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O157:H7 GN=mhpA PE=3 SV=1 50 429 1.0E-16
sp|A4T8B6|MHPA_MYCGI 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium gilvum (strain PYR-GCK) GN=mhpA PE=3 SV=1 48 404 2.0E-16
sp|B7M2Z5|MHPA_ECO8A 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Escherichia coli O8 (strain IAI1) GN=mhpA PE=3 SV=1 50 429 2.0E-16
sp|P27138|TFDB_CUPPJ 2,4-dichlorophenol 6-monooxygenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tfdB PE=3 SV=1 49 402 6.0E-16
sp|Q13QI0|MHPA_BURXL 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Burkholderia xenovorans (strain LB400) GN=mhpA PE=3 SV=1 52 429 7.0E-16
sp|A4JPY1|MHPA1_BURVG 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mhpA1 PE=3 SV=1 39 414 8.0E-16
sp|A6TAC9|MHPA_KLEP7 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mhpA PE=3 SV=1 50 429 1.0E-15
sp|A3Q339|MHPA_MYCSJ 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain JLS) GN=mhpA PE=3 SV=1 48 404 1.0E-15
sp|Q1B5E2|MHPA_MYCSS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain MCS) GN=mhpA PE=3 SV=1 48 404 2.0E-15
sp|A1UJP4|MHPA_MYCSK 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain KMS) GN=mhpA PE=3 SV=1 48 404 2.0E-15
sp|Q9S158|MHPA_COMTE 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Comamonas testosteroni GN=mhpA PE=3 SV=1 49 429 3.0E-15
sp|Q05355|HYDL_STRHA Putative polyketide hydroxylase OS=Streptomyces halstedii GN=schC PE=3 SV=1 52 397 2.0E-14
sp|A1TCX2|MHPA_MYCVP 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mhpA PE=3 SV=1 56 404 3.0E-14
sp|B5XQI9|MHPA_KLEP3 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Klebsiella pneumoniae (strain 342) GN=mhpA PE=3 SV=1 50 429 4.0E-14
sp|P32009|DNRF_STRPE Aklavinone 12-hydroxylase DnrF OS=Streptomyces peucetius GN=dnrF PE=1 SV=2 68 462 3.0E-11
sp|P42534|HYDL_STRCO Putative polyketide hydroxylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5321 PE=3 SV=2 52 398 7.0E-11
sp|A0QB57|MHPA_MYCA1 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium avium (strain 104) GN=mhpA PE=3 SV=1 211 404 1.0E-10
sp|Q742Z1|MHPA_MYCPA 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mhpA PE=3 SV=1 211 404 1.0E-10
sp|A4JQH4|MHPA2_BURVG 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mhpA2 PE=3 SV=1 52 404 2.0E-10
sp|F8G0M4|HSPB_PSEP6 6-hydroxy-3-succinoylpyridine 3-monooxygenase HspB OS=Pseudomonas putida (strain S16) GN=hspB PE=1 SV=1 51 403 8.0E-10
sp|P31020|PHEA_PSEUE Phenol 2-monooxygenase OS=Pseudomonas sp. (strain EST1001) GN=pheA PE=3 SV=1 341 403 3.0E-09
sp|A0KE38|MHPA_BURCH 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Burkholderia cenocepacia (strain HI2424) GN=mhpA PE=3 SV=1 212 404 3.0E-08
sp|Q1BGA7|MHPA_BURCA 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Burkholderia cenocepacia (strain AU 1054) GN=mhpA PE=3 SV=1 212 404 3.0E-08
sp|Q01551|TBUD_RALPI Phenol 2-monooxygenase OS=Ralstonia pickettii GN=tbuD PE=1 SV=2 292 399 8.0E-08
sp|Q84HF5|KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens GN=kmo PE=1 SV=1 51 375 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4340
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1592 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2123
Ophiocordyceps camponoti-floridani Ophcf2|00344
Ophiocordyceps camponoti-rufipedis Ophun1|7231
Ophiocordyceps kimflemingae Ophio5|7969
Ophiocordyceps subramaniannii Hirsu2|8916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1592
MAPGILDGSGANEAPVDVEHQLAPVNEDEEQDAVADLTLLRSFPEPPTECQVCVIGAGPAGLMLAATLLRCGINV
DVIDDRADQTPVGRADGLQPKTIETFRQLRLADALLQRGVRVFDISFWRSTPDEPLHRLGREVHYPPVIDVLDPY
ILLVHQGIVESLFIDDMRKRGKEVRRNTAFDSYDVLPNKAGQLQVNCRTNVTHDKRTVLTQYLVGCDGAHSKVRK
SIPDVEAVGMSQAAIWGVLDGELITDFPDIWSKTLVYSEEHGSILIIPRERNMTRFYIELKACASADRRQLGQTF
VMQQARKIMAPFSVDWKYIEWFGRYQVGQRVASRFCDAHTRVFLSGDASHTHSPKAAQGMNTSMHDSWNLSWKLN
FAVRGLAKPGLLESYEEERRKIALDLVNFDYEHANQIAGGDAVALAKNFKANVRFISGIGAEYSGSVINRDDGAP
QPGDARPGCLLPPAKVTRYIDSNPVDIQLDIPMLGQFRIFLLMWDVQQAAPFLATFCRAVAEEDPG*
Coding >OphauG2|1592
ATGGCGCCTGGCATCCTCGACGGAAGTGGCGCCAACGAGGCTCCTGTCGACGTTGAACACCAGCTGGCCCCTGTC
AACGAAGACGAGGAGCAGGACGCTGTCGCCGACTTGACCCTTCTCCGCAGCTTCCCAGAGCCTCCTACCGAATGC
CAGGTCTGCGTCATTGGCGCCGGTCCTGCCGGCCTCATGCTGGCGGCTACCCTGCTGCGCTGCGGCATCAATGTC
GATGTCATTGATGACCGCGCAGATCAGACTCCGGTGGGCAGAGCAGACGGTCTCCAGCCAAAGACGATTGAGACG
TTTCGACAGCTGCGTCTGGCCGATGCTCTGCTTCAGCGCGGCGTCCGCGTCTTTGACATTTCATTTTGGCGCAGC
ACCCCTGACGAGCCGCTCCACCGTCTGGGGCGCGAAGTCCACTACCCTCCCGTCATTGATGTCTTGGACCCCTAT
ATCCTCCTCGTCCACCAGGGAATAGTCGAGAGCCTCTTTATTGATGACATGCGCAAGCGTGGCAAGGAGGTTCGC
CGCAATACCGCCTTTGACTCGTACGATGTCCTGCCCAATAAGGCCGGCCAACTGCAGGTTAACTGTCGCACCAAC
GTTACCCATGACAAGCGAACCGTTCTCACCCAATATCTTGTAGGATGCGATGGCGCTCACTCCAAGGTGCGCAAA
AGCATCCCCGACGTTGAGGCGGTTGGAATGTCTCAGGCGGCCATTTGGGGCGTCCTCGACGGCGAGCTCATTACC
GACTTTCCAGACATTTGGTCCAAGACACTGGTCTACTCGGAGGAACACGGATCCATTCTCATTATTCCCCGCGAA
CGAAACATGACGCGATTCTACATTGAGCTCAAGGCGTGTGCATCCGCAGACCGTCGCCAGCTCGGCCAGACCTTT
GTCATGCAGCAGGCGAGGAAGATTATGGCGCCCTTTAGTGTTGACTGGAAGTATATTGAGTGGTTTGGCCGCTAC
CAGGTTGGCCAAAGGGTAGCAAGCCGCTTTTGTGACGCCCACACGCGAGTCTTTCTCTCGGGCGACGCCAGCCAT
ACACACTCGCCCAAGGCCGCCCAGGGCATGAACACGTCGATGCATGACTCGTGGAACCTTTCGTGGAAACTCAAC
TTTGCCGTTCGTGGCCTGGCCAAGCCTGGTCTTTTGGAGAGCTATGAAGAGGAGAGGCGCAAGATTGCTCTCGAC
CTGGTCAATTTTGACTATGAGCATGCCAACCAGATTGCCGGCGGCGATGCTGTTGCCCTGGCCAAGAACTTCAAG
GCCAATGTGCGCTTTATTTCGGGCATTGGTGCCGAGTACAGCGGCAGCGTCATTAATCGAGATGACGGCGCTCCC
CAGCCGGGCGATGCTCGTCCTGGCTGTCTGTTGCCTCCGGCCAAGGTGACTCGCTACATTGACTCGAACCCCGTC
GACATTCAGCTTGACATTCCCATGCTGGGGCAGTTTCGCATCTTTTTGCTCATGTGGGACGTGCAGCAAGCCGCT
CCCTTTTTGGCCACGTTTTGCCGCGCCGTGGCTGAAGAGGACCCAGGCTAG
Transcript >OphauG2|1592
ATGGCGCCTGGCATCCTCGACGGAAGTGGCGCCAACGAGGCTCCTGTCGACGTTGAACACCAGCTGGCCCCTGTC
AACGAAGACGAGGAGCAGGACGCTGTCGCCGACTTGACCCTTCTCCGCAGCTTCCCAGAGCCTCCTACCGAATGC
CAGGTCTGCGTCATTGGCGCCGGTCCTGCCGGCCTCATGCTGGCGGCTACCCTGCTGCGCTGCGGCATCAATGTC
GATGTCATTGATGACCGCGCAGATCAGACTCCGGTGGGCAGAGCAGACGGTCTCCAGCCAAAGACGATTGAGACG
TTTCGACAGCTGCGTCTGGCCGATGCTCTGCTTCAGCGCGGCGTCCGCGTCTTTGACATTTCATTTTGGCGCAGC
ACCCCTGACGAGCCGCTCCACCGTCTGGGGCGCGAAGTCCACTACCCTCCCGTCATTGATGTCTTGGACCCCTAT
ATCCTCCTCGTCCACCAGGGAATAGTCGAGAGCCTCTTTATTGATGACATGCGCAAGCGTGGCAAGGAGGTTCGC
CGCAATACCGCCTTTGACTCGTACGATGTCCTGCCCAATAAGGCCGGCCAACTGCAGGTTAACTGTCGCACCAAC
GTTACCCATGACAAGCGAACCGTTCTCACCCAATATCTTGTAGGATGCGATGGCGCTCACTCCAAGGTGCGCAAA
AGCATCCCCGACGTTGAGGCGGTTGGAATGTCTCAGGCGGCCATTTGGGGCGTCCTCGACGGCGAGCTCATTACC
GACTTTCCAGACATTTGGTCCAAGACACTGGTCTACTCGGAGGAACACGGATCCATTCTCATTATTCCCCGCGAA
CGAAACATGACGCGATTCTACATTGAGCTCAAGGCGTGTGCATCCGCAGACCGTCGCCAGCTCGGCCAGACCTTT
GTCATGCAGCAGGCGAGGAAGATTATGGCGCCCTTTAGTGTTGACTGGAAGTATATTGAGTGGTTTGGCCGCTAC
CAGGTTGGCCAAAGGGTAGCAAGCCGCTTTTGTGACGCCCACACGCGAGTCTTTCTCTCGGGCGACGCCAGCCAT
ACACACTCGCCCAAGGCCGCCCAGGGCATGAACACGTCGATGCATGACTCGTGGAACCTTTCGTGGAAACTCAAC
TTTGCCGTTCGTGGCCTGGCCAAGCCTGGTCTTTTGGAGAGCTATGAAGAGGAGAGGCGCAAGATTGCTCTCGAC
CTGGTCAATTTTGACTATGAGCATGCCAACCAGATTGCCGGCGGCGATGCTGTTGCCCTGGCCAAGAACTTCAAG
GCCAATGTGCGCTTTATTTCGGGCATTGGTGCCGAGTACAGCGGCAGCGTCATTAATCGAGATGACGGCGCTCCC
CAGCCGGGCGATGCTCGTCCTGGCTGTCTGTTGCCTCCGGCCAAGGTGACTCGCTACATTGACTCGAACCCCGTC
GACATTCAGCTTGACATTCCCATGCTGGGGCAGTTTCGCATCTTTTTGCTCATGTGGGACGTGCAGCAAGCCGCT
CCCTTTTTGGCCACGTTTTGCCGCGCCGTGGCTGAAGAGGACCCAGGCTAG
Gene >OphauG2|1592
ATGGCGCCTGGCATCCTCGACGGAAGTGGCGCCAACGAGGCTCCTGTCGACGTTGAACACCAGCTGGCCCCTGTC
AACGAAGACGAGGAGCAGGACGCTGTCGCCGACTTGACCCTTCTCCGCAGCTTCCCAGAGCCTCCTACCGAATGC
CAGGTCTGCGTCATTGGCGCCGGTCCTGCCGGCCTCATGCTGGCGGCTACCCTGCTGCGCTGCGGCATCAATGTC
GATGTCATTGATGACCGCGCAGATCAGACTCCGGTGGGCAGGTAAGAGAGGCCTCCTCCTCCCTGCATCACCTGC
CACCCCCCCGTCTCTGCCACGCCCACTGTGCGCTCGCTGACCTGCCTTGCACAGAGCAGACGGTCTCCAGCCAAA
GACGATTGAGACGTTTCGACAGCTGCGTCTGGCCGATGCTCTGCTTCAGCGCGGCGTCCGCGTCTTTGACATTTC
ATTTTGGCGCAGCACCCCTGACGAGCCGCTCCACCGTCTGGGGCGCGAAGTCCACTACCCTCCCGTCATTGATGT
CTTGGACCCCTATATCCTCCTCGTCCACCAGGGAATAGTCGAGAGCCTCTTTATTGATGACATGCGCAAGCGTGG
CAAGGAGGTTCGCCGCAATACCGCCTTTGACTCGTACGATGTCCTGCCCAATAAGGCCGGCCAACTGCAGGTTAA
CTGTCGCACCAACGTTACCCATGACAAGCGAACCGTTCTCACCCAATATCTTGTAGGATGTCAGTCCAAGCTGGC
TCTCTTTGTAATGTTTTGGTTTTACTGATTGTATTGTCGCAGGCGATGGCGCTCACTCCAAGGTGCGCAAAAGCA
TCCCCGACGTTGAGGCGGTTGGAATGTCTCAGGCGGCCATTTGGGGCGTCCTCGACGGCGAGCTCATTACCGACT
TTCCAGACATTTGGTCCAAGACACTGGTCTACTCGGAGGAACACGGATCCATTCTCATTATTCCCCGCGAACGAA
ACATGACGCGATTCTACATTGAGCTCAAGGCGTGTGCATCCGCAGACCGTCGCCAGCTCGGCCAGACCTTTGTCA
TGCAGCAGGCGAGGAAGATTATGGCGCCCTTTAGTGTTGACTGGAAGTATATTGAGTGGTTTGGCCGCTACCAGG
TTGGCCAAAGGGTAGCAAGCCGCTTTTGTGACGCCCACACGCGAGTCTTTCTCTCGGGCGACGCCAGCCATACAC
ACTCGCCCAAGGCCGCCCAGGGCATGAACACGTCGATGCATGACTCGTGGAACCTTTCGTGGAAACTCAACTTTG
CCGTTCGTGGCCTGGCCAAGCCTGGTCTTTTGGAGAGCTATGAAGAGGAGAGGCGCAAGATTGCTCTCGACCTGG
TCAATTTTGACTATGAGCATGCCAACCAGATTGCCGGCGGCGATGCTGTTGCCCTGGCCAAGAACTTCAAGGCCA
ATGTGCGCTTTATTTCGGGCATTGGTGCCGAGTACAGCGGCAGCGTCATTAATCGAGATGACGGCGCTCCCCAGC
CGGGCGATGCTCGTCCTGGCTGTCTGTTGCCTCCGGCCAAGGTGACTCGCTACATTGACTCGAACCCCGTCGACA
TTCAGCTTGACATTCCCATGCTGGGGCAGTTTCGCATCTTTTTGCTCATGTGGGACGTGCAGCAAGCCGCTCCCT
TTTTGGCCACGTTTTGCCGCGCCGTGGCTGAAGAGGAGTCGTTTATGAGCCAGCTCTCGGCGGCGGCAAGTCGCT
CATATGCCGAGCAGCCCAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail