Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1586
Gene name
LocationContig_149:16097..17747
Strand-
Gene length (bp)1650
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01585 G-patch G-patch domain 1.5E-12 313 353
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.5E-04 419 463

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P42698|DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana GN=DRT111 PE=1 SV=2 312 475 2.0E-15
sp|Q8JZX4|SPF45_MOUSE Splicing factor 45 OS=Mus musculus GN=Rbm17 PE=1 SV=1 317 473 1.0E-11
sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens GN=RBM17 PE=1 SV=1 317 473 7.0E-11

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1586
MTAPPPPPAARPGLSLYADLHDPNESSNATISAAPVVYGQTNAASAETQKPNAALQFQPHIRRPPVKQSKTKSAF
PKKIVKSETVDIAPVPPAAPIASTQAPPKTSLADWAPTEQDEWMYGTGEKRQRGGRKKKKRQQQDRTEETNWDEF
YDPSKPTNVEEYVKSDEKITEVLEWKAQLYRHRKRRASSDISSDDDNVPSMPNQFAPPPSMAFAPPPMSPPHPAS
PPRTNDERYGSHPNTTETPVPDLNPPPPPSQPASNPTLPPASTGATISRAPVMYTQMPSLENPASHAEPSAPDNG
NSEESQRSRRPGQSGFALRLMNKYGWTKGTGLGADESGIVNPLRVHVDKRRKKADADGGGWAEPSAKGKIIGGHR
KAEQSKFGKMSEVIVLGNMLENMPDLQSEIANGLGQEIGEECGEKYGRVERIYIDQEHRQVFIKFTDQVSALRAV
NELDERIFNGNTIAPRFYDTETFERGVYTSKK*
Coding >OphauG2|1586
ATGACAGCTCCTCCTCCTCCTCCTGCTGCGCGTCCCGGCCTCTCCCTATACGCTGATTTACACGATCCCAACGAA
TCTTCCAACGCAACCATTTCCGCCGCGCCAGTAGTATACGGCCAGACCAACGCCGCGTCAGCAGAGACTCAGAAG
CCCAATGCTGCTCTTCAGTTCCAGCCACATATTCGGCGTCCGCCAGTCAAGCAATCAAAGACTAAATCAGCTTTT
CCAAAGAAAATCGTCAAAAGTGAGACTGTGGACATAGCTCCTGTACCACCGGCGGCTCCTATAGCTTCTACTCAA
GCGCCGCCAAAGACTTCGCTGGCCGACTGGGCTCCCACTGAGCAGGATGAATGGATGTACGGCACTGGGGAGAAG
CGCCAGCGTGGCGGTCGCAAGAAGAAAAAGAGGCAACAGCAAGACAGAACTGAGGAAACCAACTGGGACGAGTTC
TACGACCCGAGCAAGCCGACTAACGTCGAGGAATATGTAAAGAGTGATGAGAAGATTACCGAGGTGCTCGAATGG
AAGGCCCAGTTATACAGACATCGCAAGAGACGTGCCTCCAGCGACATCTCGAGTGATGACGATAATGTCCCTTCT
ATGCCGAATCAATTTGCACCACCTCCATCAATGGCATTTGCCCCGCCGCCCATGTCACCTCCACATCCTGCATCG
CCTCCTCGCACCAACGATGAACGGTACGGTAGCCATCCAAATACTACTGAAACGCCTGTACCAGACTTGAATCCT
CCTCCACCGCCATCACAACCAGCTAGCAATCCCACCCTGCCACCCGCATCCACCGGAGCCACTATATCACGAGCC
CCGGTAATGTACACGCAAATGCCGTCTTTAGAAAACCCCGCCAGCCATGCAGAGCCATCTGCTCCCGACAACGGC
AACTCTGAAGAGTCGCAGCGCTCAAGACGGCCAGGCCAATCTGGCTTCGCCCTCCGCCTCATGAACAAGTACGGC
TGGACAAAGGGTACCGGCCTCGGCGCAGACGAGTCTGGCATCGTCAACCCTCTCCGCGTCCACGTCGACAAGCGC
CGCAAGAAAGCAGATGCAGACGGCGGCGGCTGGGCCGAACCTTCCGCCAAGGGCAAGATAATTGGTGGACACCGC
AAGGCAGAGCAAAGCAAATTTGGCAAAATGAGCGAAGTCATCGTCTTGGGCAATATGCTGGAGAATATGCCAGAC
CTGCAAAGCGAGATTGCAAATGGACTTGGTCAAGAAATCGGTGAAGAGTGTGGAGAAAAGTACGGACGTGTGGAG
CGTATATACATTGACCAAGAACACCGCCAAGTCTTCATAAAGTTTACCGACCAAGTATCAGCTCTTCGCGCCGTC
AACGAGCTCGATGAGCGCATCTTTAATGGCAACACCATTGCCCCAAGGTTTTACGATACAGAAACGTTTGAGCGA
GGCGTCTATACCTCAAAAAAGTAG
Transcript >OphauG2|1586
ATGACAGCTCCTCCTCCTCCTCCTGCTGCGCGTCCCGGCCTCTCCCTATACGCTGATTTACACGATCCCAACGAA
TCTTCCAACGCAACCATTTCCGCCGCGCCAGTAGTATACGGCCAGACCAACGCCGCGTCAGCAGAGACTCAGAAG
CCCAATGCTGCTCTTCAGTTCCAGCCACATATTCGGCGTCCGCCAGTCAAGCAATCAAAGACTAAATCAGCTTTT
CCAAAGAAAATCGTCAAAAGTGAGACTGTGGACATAGCTCCTGTACCACCGGCGGCTCCTATAGCTTCTACTCAA
GCGCCGCCAAAGACTTCGCTGGCCGACTGGGCTCCCACTGAGCAGGATGAATGGATGTACGGCACTGGGGAGAAG
CGCCAGCGTGGCGGTCGCAAGAAGAAAAAGAGGCAACAGCAAGACAGAACTGAGGAAACCAACTGGGACGAGTTC
TACGACCCGAGCAAGCCGACTAACGTCGAGGAATATGTAAAGAGTGATGAGAAGATTACCGAGGTGCTCGAATGG
AAGGCCCAGTTATACAGACATCGCAAGAGACGTGCCTCCAGCGACATCTCGAGTGATGACGATAATGTCCCTTCT
ATGCCGAATCAATTTGCACCACCTCCATCAATGGCATTTGCCCCGCCGCCCATGTCACCTCCACATCCTGCATCG
CCTCCTCGCACCAACGATGAACGGTACGGTAGCCATCCAAATACTACTGAAACGCCTGTACCAGACTTGAATCCT
CCTCCACCGCCATCACAACCAGCTAGCAATCCCACCCTGCCACCCGCATCCACCGGAGCCACTATATCACGAGCC
CCGGTAATGTACACGCAAATGCCGTCTTTAGAAAACCCCGCCAGCCATGCAGAGCCATCTGCTCCCGACAACGGC
AACTCTGAAGAGTCGCAGCGCTCAAGACGGCCAGGCCAATCTGGCTTCGCCCTCCGCCTCATGAACAAGTACGGC
TGGACAAAGGGTACCGGCCTCGGCGCAGACGAGTCTGGCATCGTCAACCCTCTCCGCGTCCACGTCGACAAGCGC
CGCAAGAAAGCAGATGCAGACGGCGGCGGCTGGGCCGAACCTTCCGCCAAGGGCAAGATAATTGGTGGACACCGC
AAGGCAGAGCAAAGCAAATTTGGCAAAATGAGCGAAGTCATCGTCTTGGGCAATATGCTGGAGAATATGCCAGAC
CTGCAAAGCGAGATTGCAAATGGACTTGGTCAAGAAATCGGTGAAGAGTGTGGAGAAAAGTACGGACGTGTGGAG
CGTATATACATTGACCAAGAACACCGCCAAGTCTTCATAAAGTTTACCGACCAAGTATCAGCTCTTCGCGCCGTC
AACGAGCTCGATGAGCGCATCTTTAATGGCAACACCATTGCCCCAAGGTTTTACGATACAGAAACGTTTGAGCGA
GGCGTCTATACCTCAAAAAAGTAG
Gene >OphauG2|1586
ATGACAGCTCCTCCTCCTCCTCCTGCTGCGCGTCCCGGCCTCTCCCTATACGCTGATTTACACGATCCCAACGAA
TCTTCCAACGCAACCATTTCCGCCGCGCCAGTAGTATACGGCCAGACCAACGCCGCGTCAGCAGAGACTCAGAAG
CCCAATGCTGCTCTTCAGTTCCAGCCACATATTCGGCGTCCGCCAGTCAAGCAATCAAAGACTAAATCAGCTTTT
CCAAAGAAAATCGTCAAAAGTGAGACTGTGGACATAGCTCCTGTACCACCGGCGGCTCCTATAGCTTCTACTCAA
GCGCCGCCAAAGACTTCGCTGGCCGACTGGGCTCCCACTGAGCAGGATGAATGGATGTACGGCACTGGGGAGAAG
CGCCAGCGTGGCGGTCGCAAGAAGAAAAAGAGGCAACAGCAAGACAGAACTGAGGAAACCAACTGGGACGAGTTC
TACGACCCGAGCAAGCCGACTAACGTCGAGGAATATGTAAAGAGTGATGAGAAGATTACCGAGGTGCTCGAATGG
AAGGCCCAGTTATACAGACATCGCAAGAGACGTGCCTCCAGCGACATCTCGAGTGATGACGATAATGTCCCTTCT
ATGCCGAGTAGGTCCTCGTTCGCTCTTGGGTTCATGGCCCATGTATATGCTAATATTCTTTTCATAGATCAATTT
GCACCACCTCCATCAATGGCATTTGCCCCGCCGCCCATGTCACCTCCACATCCTGCATCGCCTCCTCGCACCAAC
GATGAACGGTACGGTAGCCATCCAAATACTACTGAAACGCCTGTACCAGACTTGAATCCTCCTCCACCGCCATCA
CAACCAGCTAGCAATCCCACCCTGCCACCCGCATCCACCGGAGCCACTATATCACGAGCCCCGGTAATGTACACG
CAAATGCCGTCTTTAGAAAACCCCGCCAGCCATGCAGAGCCATCTGCTCCCGACAACGGCAACTCTGAAGAGTCG
CAGCGCTCAAGACGGCCAGGCCAATCTGGCTTCGCCCTCCGCCTCATGAACAAGTACGGCTGGACAAAGGGTACC
GGCCTCGGCGCAGACGAGTCTGGCATCGTCAACCCTCTCCGCGTCCACGTCGACAAGCGCCGCAAGAAAGCAGAT
GCAGACGGCGGCGGCTGGGCCGAACCTTCCGCCAAGGGCAAGATAATTGGTGGACACCGCAAGGCAGAGCAAAGC
AAATTTGGCAAAATGAGCGAAGTCATCGTCTTGGGCAATATGCTGGAGAATATGCCAGACCTGCAAAGCGAGATT
GCAAATGGACTTGGTCAAGAAATCGGTGAAGAGTGTGGAGAAAAGGTGAGCTCACATTCAAACAGTTCTCTCTTT
TTTTTTCGCTATTCAACAAATATTCCTTCTCGACGTCAGCTAACAAGCAATACAGTACGGACGTGTGGAGCGTAT
ATACATTGACCAAGAACACCGCCAAGTCTTCATAAAGTTTACCGACCAAGTATCAGCTCTTCGCGTACGTCAACT
TGCCTTGTTATCCACTTTTAGACGCTGACACTTCATCATGGACAGGCCGTCAACGAGCTCGATGAGCGCATCTTT
AATGGCAACACCATTGCCCCAAGGTTTTACGATACAGAAACGTTTGAGCGAGGCGTCTATACCTCAAAAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail