Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1578
Gene name
LocationContig_1488:151..3564
Strand+
Gene length (bp)3413
Transcript length (bp)3300
Coding sequence length (bp)3300
Protein length (aa) 1100

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 4.3E-31 642 799
PF11987 IF-2 Translation-initiation factor 2 1.1E-25 962 1056
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.0E-08 642 748

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25038|IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 559 1095 6.0E-135
sp|B1ZDQ8|IF2_METPB Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 551 1089 1.0E-121
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 555 1081 2.0E-119
sp|A1UU50|IF2_BARBK Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 551 1083 2.0E-118
sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 500 1081 3.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25038|IF2M_YEAST Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2 559 1095 6.0E-135
sp|B1ZDQ8|IF2_METPB Translation initiation factor IF-2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=infB PE=3 SV=1 551 1089 1.0E-121
sp|A0KNE3|IF2_AERHH Translation initiation factor IF-2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=infB PE=3 SV=1 555 1081 2.0E-119
sp|A1UU50|IF2_BARBK Translation initiation factor IF-2 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=infB PE=3 SV=1 551 1083 2.0E-118
sp|A1RGX5|IF2_SHESW Translation initiation factor IF-2 OS=Shewanella sp. (strain W3-18-1) GN=infB PE=3 SV=1 500 1081 3.0E-118
sp|A4Y9C0|IF2_SHEPC Translation initiation factor IF-2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=infB PE=3 SV=1 500 1081 3.0E-118
sp|A0KTZ6|IF2_SHESA Translation initiation factor IF-2 OS=Shewanella sp. (strain ANA-3) GN=infB PE=3 SV=1 500 1081 3.0E-118
sp|A4SJR5|IF2_AERS4 Translation initiation factor IF-2 OS=Aeromonas salmonicida (strain A449) GN=infB PE=3 SV=1 555 1081 5.0E-118
sp|Q0HXR5|IF2_SHESR Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-7) GN=infB PE=3 SV=1 500 1081 7.0E-118
sp|Q0HLG1|IF2_SHESM Translation initiation factor IF-2 OS=Shewanella sp. (strain MR-4) GN=infB PE=3 SV=1 500 1081 7.0E-118
sp|Q11BC8|IF2_CHESB Translation initiation factor IF-2 OS=Chelativorans sp. (strain BNC1) GN=infB PE=3 SV=1 546 1083 1.0E-117
sp|Q8EHL5|IF2_SHEON Translation initiation factor IF-2 OS=Shewanella oneidensis (strain MR-1) GN=infB PE=3 SV=1 500 1081 1.0E-117
sp|A1S462|IF2_SHEAM Translation initiation factor IF-2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=infB PE=3 SV=1 489 1081 3.0E-117
sp|Q2RMS0|IF2_RHORT Translation initiation factor IF-2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=infB PE=3 SV=2 516 1084 4.0E-117
sp|A9IMT5|IF2_BART1 Translation initiation factor IF-2 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=infB PE=3 SV=1 551 1083 5.0E-117
sp|A8LQ56|IF2_DINSH Translation initiation factor IF-2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=infB PE=3 SV=1 531 1084 8.0E-117
sp|O59683|IF2M_SCHPO Translation initiation factor IF-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.15c PE=3 SV=1 557 1095 2.0E-116
sp|Q5LWL4|IF2_RUEPO Translation initiation factor IF-2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=infB PE=3 SV=1 531 1084 3.0E-116
sp|Q98BI8|IF2_RHILO Translation initiation factor IF-2 OS=Rhizobium loti (strain MAFF303099) GN=infB PE=3 SV=1 551 1089 3.0E-116
sp|A7HZ93|IF2_PARL1 Translation initiation factor IF-2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=infB PE=3 SV=1 555 1089 7.0E-116
sp|Q086H2|IF2_SHEFN Translation initiation factor IF-2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=infB PE=3 SV=1 500 1081 1.0E-115
sp|B4RC55|IF2_PHEZH Translation initiation factor IF-2 OS=Phenylobacterium zucineum (strain HLK1) GN=infB PE=3 SV=1 553 1083 1.0E-115
sp|A8IG20|IF2_AZOC5 Translation initiation factor IF-2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=infB PE=3 SV=1 515 1084 2.0E-115
sp|Q6G4W7|IF2_BARHE Translation initiation factor IF-2 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=infB PE=3 SV=1 551 1083 2.0E-115
sp|Q9ZF28|IF2_KLEOX Translation initiation factor IF-2 OS=Klebsiella oxytoca GN=infB PE=3 SV=1 551 1081 3.0E-115
sp|A9KZX1|IF2_SHEB9 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS195) GN=infB PE=3 SV=1 500 1081 3.0E-115
sp|A6WRG8|IF2_SHEB8 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS185) GN=infB PE=3 SV=1 500 1081 3.0E-115
sp|A3D7K6|IF2_SHEB5 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=infB PE=3 SV=1 500 1081 3.0E-115
sp|B8E6N2|IF2_SHEB2 Translation initiation factor IF-2 OS=Shewanella baltica (strain OS223) GN=infB PE=3 SV=1 500 1081 3.0E-115
sp|Q12QI1|IF2_SHEDO Translation initiation factor IF-2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=infB PE=3 SV=1 500 1081 4.0E-115
sp|B0T167|IF2_CAUSK Translation initiation factor IF-2 OS=Caulobacter sp. (strain K31) GN=infB PE=3 SV=1 532 1084 5.0E-115
sp|Q9ZF25|IF2_ENTCL Translation initiation factor IF-2 OS=Enterobacter cloacae GN=infB PE=3 SV=1 551 1081 7.0E-115
sp|Q9AC25|IF2_CAUCR Translation initiation factor IF-2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=infB PE=3 SV=2 532 1084 9.0E-115
sp|B0BNR5|IF2_ACTPJ Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=infB PE=3 SV=1 550 1081 3.0E-114
sp|A1B587|IF2_PARDP Translation initiation factor IF-2 OS=Paracoccus denitrificans (strain Pd 1222) GN=infB PE=3 SV=1 495 1084 3.0E-114
sp|Q6G0P2|IF2_BARQU Translation initiation factor IF-2 OS=Bartonella quintana (strain Toulouse) GN=infB PE=3 SV=1 551 1083 3.0E-114
sp|B3H163|IF2_ACTP7 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=infB PE=3 SV=1 550 1081 9.0E-114
sp|A3N005|IF2_ACTP2 Translation initiation factor IF-2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=infB PE=3 SV=1 550 1081 9.0E-114
sp|P44323|IF2_HAEIN Translation initiation factor IF-2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=infB PE=3 SV=1 557 1081 1.0E-113
sp|A3QGU5|IF2_SHELP Translation initiation factor IF-2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=infB PE=3 SV=1 552 1081 1.0E-113
sp|A5UBT6|IF2_HAEIE Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittEE) GN=infB PE=3 SV=1 557 1081 1.0E-113
sp|Q9ZCZ8|IF2_RICPR Translation initiation factor IF-2 OS=Rickettsia prowazekii (strain Madrid E) GN=infB PE=3 SV=1 496 1083 2.0E-113
sp|B9JYK6|IF2_AGRVS Translation initiation factor IF-2 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=infB PE=3 SV=1 551 1089 3.0E-113
sp|B8EIA7|IF2_METSB Translation initiation factor IF-2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=infB PE=3 SV=1 443 1084 5.0E-113
sp|A3PNL2|IF2_RHOS1 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=infB PE=3 SV=1 551 1084 6.0E-113
sp|Q16D38|IF2_ROSDO Translation initiation factor IF-2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=infB PE=3 SV=1 531 1083 7.0E-113
sp|Q3IYN5|IF2_RHOS4 Translation initiation factor IF-2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=infB PE=3 SV=1 551 1084 8.0E-113
sp|Q68WI4|IF2_RICTY Translation initiation factor IF-2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=infB PE=3 SV=1 496 1083 1.0E-112
sp|P57873|IF2_PASMU Translation initiation factor IF-2 OS=Pasteurella multocida (strain Pm70) GN=infB PE=3 SV=1 507 1081 2.0E-112
sp|A6VNE0|IF2_ACTSZ Translation initiation factor IF-2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=infB PE=3 SV=1 507 1081 3.0E-112
sp|Q5QTY8|IF2_IDILO Translation initiation factor IF-2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=infB PE=3 SV=1 555 1081 3.0E-112
sp|Q1MN39|IF2_RHIL3 Translation initiation factor IF-2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=infB PE=3 SV=1 471 1083 3.0E-112
sp|Q4QK37|IF2_HAEI8 Translation initiation factor IF-2 OS=Haemophilus influenzae (strain 86-028NP) GN=infB PE=3 SV=1 557 1081 3.0E-112
sp|A5UF34|IF2_HAEIG Translation initiation factor IF-2 OS=Haemophilus influenzae (strain PittGG) GN=infB PE=3 SV=1 557 1081 4.0E-112
sp|Q2KDZ5|IF2_RHIEC Translation initiation factor IF-2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=infB PE=3 SV=1 478 1083 4.0E-112
sp|Q2A1G8|IF2_FRATH Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=infB PE=3 SV=1 550 1081 4.0E-112
sp|Q0BK70|IF2_FRATO Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=infB PE=3 SV=1 550 1081 5.0E-112
sp|A7NEI8|IF2_FRATF Translation initiation factor IF-2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=infB PE=3 SV=1 550 1081 5.0E-112
sp|A8G907|IF2_SERP5 Translation initiation factor IF-2 OS=Serratia proteamaculans (strain 568) GN=infB PE=3 SV=1 555 1081 5.0E-112
sp|Q1RIX0|IF2_RICBR Translation initiation factor IF-2 OS=Rickettsia bellii (strain RML369-C) GN=infB PE=3 SV=1 532 1083 5.0E-112
sp|Q5NIL7|IF2_FRATT Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=infB PE=3 SV=1 550 1081 5.0E-112
sp|Q14K20|IF2_FRAT1 Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=infB PE=3 SV=1 550 1081 5.0E-112
sp|P46198|IF2M_BOVIN Translation initiation factor IF-2, mitochondrial OS=Bos taurus GN=MTIF2 PE=1 SV=1 628 1088 7.0E-112
sp|A0Q8F3|IF2_FRATN Translation initiation factor IF-2 OS=Francisella tularensis subsp. novicida (strain U112) GN=infB PE=3 SV=1 550 1081 8.0E-112
sp|B2SEW7|IF2_FRATM Translation initiation factor IF-2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=infB PE=3 SV=1 550 1081 9.0E-112
sp|B3PI96|IF2_CELJU Translation initiation factor IF-2 OS=Cellvibrio japonicus (strain Ueda107) GN=infB PE=3 SV=1 557 1082 9.0E-112
sp|A8F223|IF2_RICM5 Translation initiation factor IF-2 OS=Rickettsia massiliae (strain Mtu5) GN=infB PE=3 SV=1 496 1083 9.0E-112
sp|A8GW31|IF2_RICB8 Translation initiation factor IF-2 OS=Rickettsia bellii (strain OSU 85-389) GN=infB PE=3 SV=1 532 1083 9.0E-112
sp|Q2VZV0|IF2_MAGSA Translation initiation factor IF-2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=infB PE=3 SV=1 532 1084 1.0E-111
sp|A4IW10|IF2_FRATW Translation initiation factor IF-2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=infB PE=3 SV=1 550 1081 1.0E-111
sp|A8GSP4|IF2_RICRS Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=infB PE=3 SV=1 551 1083 1.0E-111
sp|B0BY61|IF2_RICRO Translation initiation factor IF-2 OS=Rickettsia rickettsii (strain Iowa) GN=infB PE=3 SV=1 551 1083 1.0E-111
sp|Q92SW4|IF2_RHIME Translation initiation factor IF-2 OS=Rhizobium meliloti (strain 1021) GN=infB PE=3 SV=1 547 1083 1.0E-111
sp|Q5FQM3|IF2_GLUOX Translation initiation factor IF-2 OS=Gluconobacter oxydans (strain 621H) GN=infB PE=3 SV=1 553 1089 1.0E-111
sp|P46199|IF2M_HUMAN Translation initiation factor IF-2, mitochondrial OS=Homo sapiens GN=MTIF2 PE=1 SV=2 626 1088 1.0E-111
sp|B3PXE3|IF2_RHIE6 Translation initiation factor IF-2 OS=Rhizobium etli (strain CIAT 652) GN=infB PE=3 SV=1 471 1083 1.0E-111
sp|C4L8X4|IF2_TOLAT Translation initiation factor IF-2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=infB PE=3 SV=1 555 1081 1.0E-111
sp|Q0C5Z5|IF2_HYPNA Translation initiation factor IF-2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=infB PE=3 SV=1 551 1083 1.0E-111
sp|C5BPV9|IF2_TERTT Translation initiation factor IF-2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=infB PE=3 SV=1 559 1081 3.0E-111
sp|A6UF29|IF2_SINMW Translation initiation factor IF-2 OS=Sinorhizobium medicae (strain WSM419) GN=infB PE=3 SV=1 547 1083 3.0E-111
sp|A8GNW1|IF2_RICAH Translation initiation factor IF-2 OS=Rickettsia akari (strain Hartford) GN=infB PE=3 SV=1 551 1083 4.0E-111
sp|Q0BPG2|IF2_GRABC Translation initiation factor IF-2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=infB PE=3 SV=1 555 1084 4.0E-111
sp|Q91YJ5|IF2M_MOUSE Translation initiation factor IF-2, mitochondrial OS=Mus musculus GN=Mtif2 PE=1 SV=2 626 1088 7.0E-111
sp|Q92HF5|IF2_RICCN Translation initiation factor IF-2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=infB PE=3 SV=1 551 1083 7.0E-111
sp|Q8UJ51|IF2_AGRFC Translation initiation factor IF-2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=infB PE=3 SV=1 547 1083 8.0E-111
sp|Q1GCH2|IF2_RUEST Translation initiation factor IF-2 OS=Ruegeria sp. (strain TM1040) GN=infB PE=3 SV=1 551 1084 9.0E-111
sp|Q7VLI2|IF2_HAEDU Translation initiation factor IF-2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=infB PE=3 SV=1 550 1081 1.0E-110
sp|B0TQA2|IF2_SHEHH Translation initiation factor IF-2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=infB PE=3 SV=1 559 1081 1.0E-110
sp|Q4UL51|IF2_RICFE Translation initiation factor IF-2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=infB PE=3 SV=1 551 1083 1.0E-110
sp|Q8FXT2|IF2_BRUSU Translation initiation factor IF-2 OS=Brucella suis biovar 1 (strain 1330) GN=infB PE=3 SV=1 547 1083 1.0E-110
sp|B0CK11|IF2_BRUSI Translation initiation factor IF-2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=infB PE=3 SV=1 547 1083 2.0E-110
sp|Q57AA0|IF2_BRUAB Translation initiation factor IF-2 OS=Brucella abortus biovar 1 (strain 9-941) GN=infB PE=3 SV=1 547 1083 2.0E-110
sp|Q2YQR7|IF2_BRUA2 Translation initiation factor IF-2 OS=Brucella abortus (strain 2308) GN=infB PE=3 SV=1 547 1083 2.0E-110
sp|Q8YEB3|IF2_BRUME Translation initiation factor IF-2 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=infB PE=3 SV=2 547 1083 2.0E-110
sp|C5BFB7|IF2_EDWI9 Translation initiation factor IF-2 OS=Edwardsiella ictaluri (strain 93-146) GN=infB PE=3 SV=1 551 1081 3.0E-110
sp|A9M9Z4|IF2_BRUC2 Translation initiation factor IF-2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=infB PE=3 SV=1 547 1083 5.0E-110
sp|Q65SK9|IF2_MANSM Translation initiation factor IF-2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=infB PE=3 SV=1 551 1081 5.0E-110
sp|Q0I3P5|IF2_HAES1 Translation initiation factor IF-2 OS=Haemophilus somnus (strain 129Pt) GN=infB PE=3 SV=1 557 1081 9.0E-110
sp|A5VTB2|IF2_BRUO2 Translation initiation factor IF-2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=infB PE=3 SV=2 547 1083 9.0E-110
sp|B0UU13|IF2_HISS2 Translation initiation factor IF-2 OS=Histophilus somni (strain 2336) GN=infB PE=3 SV=1 557 1081 1.0E-109
sp|Q21C31|IF2_RHOPB Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB18) GN=infB PE=3 SV=1 551 1084 1.0E-109
sp|Q28WF7|IF2_JANSC Translation initiation factor IF-2 OS=Jannaschia sp. (strain CCS1) GN=infB PE=3 SV=1 480 1084 1.0E-109
sp|Q0AK69|IF2_MARMM Translation initiation factor IF-2 OS=Maricaulis maris (strain MCS10) GN=infB PE=3 SV=1 515 1089 2.0E-109
sp|A1U600|IF2_MARHV Translation initiation factor IF-2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=infB PE=3 SV=1 555 1081 6.0E-109
sp|A8FYS0|IF2_SHESH Translation initiation factor IF-2 OS=Shewanella sediminis (strain HAW-EB3) GN=infB PE=3 SV=1 559 1081 1.0E-108
sp|B0TWR3|IF2_FRAP2 Translation initiation factor IF-2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=infB PE=3 SV=1 550 1081 1.0E-108
sp|B1KRR0|IF2_SHEWM Translation initiation factor IF-2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=infB PE=3 SV=1 559 1081 1.0E-108
sp|Q6NCN5|IF2_RHOPA Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=infB PE=3 SV=1 551 1084 2.0E-108
sp|A5FV21|IF2_ACICJ Translation initiation factor IF-2 OS=Acidiphilium cryptum (strain JF-5) GN=infB PE=3 SV=1 555 1084 2.0E-108
sp|Q89WA9|IF2_BRADU Translation initiation factor IF-2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=infB PE=3 SV=1 551 1084 3.0E-108
sp|A4WEY3|IF2_ENT38 Translation initiation factor IF-2 OS=Enterobacter sp. (strain 638) GN=infB PE=3 SV=1 551 1081 3.0E-108
sp|Q89AF5|IF2_BUCBP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=infB PE=3 SV=1 489 1081 3.0E-108
sp|Q1QS64|IF2_NITHX Translation initiation factor IF-2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=infB PE=3 SV=1 551 1084 4.0E-108
sp|A8H740|IF2_SHEPA Translation initiation factor IF-2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=infB PE=3 SV=1 559 1081 5.0E-108
sp|B2IIJ7|IF2_BEII9 Translation initiation factor IF-2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=infB PE=3 SV=1 548 1084 5.0E-108
sp|B8CKH3|IF2_SHEPW Translation initiation factor IF-2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=infB PE=3 SV=1 559 1081 9.0E-108
sp|Q482T9|IF2_COLP3 Translation initiation factor IF-2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=infB PE=3 SV=1 550 1081 1.0E-107
sp|A4J5X2|IF2_DESRM Translation initiation factor IF-2 OS=Desulfotomaculum reducens (strain MI-1) GN=infB PE=3 SV=1 555 1081 2.0E-107
sp|A8EYF4|IF2_RICCK Translation initiation factor IF-2 OS=Rickettsia canadensis (strain McKiel) GN=infB PE=3 SV=1 496 1083 2.0E-107
sp|B8JFY6|IF2_ANAD2 Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=infB PE=3 SV=1 555 1083 2.0E-107
sp|Q2J2J9|IF2_RHOP2 Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain HaA2) GN=infB PE=3 SV=1 551 1084 3.0E-107
sp|A7MQE1|IF2_CROS8 Translation initiation factor IF-2 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=infB PE=3 SV=1 551 1081 3.0E-107
sp|Q2SML3|IF2_HAHCH Translation initiation factor IF-2 OS=Hahella chejuensis (strain KCTC 2396) GN=infB PE=3 SV=1 497 1081 4.0E-107
sp|B4UHG0|IF2_ANASK Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain K) GN=infB PE=3 SV=1 555 1083 4.0E-107
sp|A5E866|IF2_BRASB Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=infB PE=3 SV=1 551 1084 5.0E-107
sp|A6WWW5|IF2_OCHA4 Translation initiation factor IF-2 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=infB PE=3 SV=1 547 1083 7.0E-107
sp|A4YJE9|IF2_BRASO Translation initiation factor IF-2 OS=Bradyrhizobium sp. (strain ORS278) GN=infB PE=3 SV=1 551 1084 7.0E-107
sp|A8AQ58|IF2_CITK8 Translation initiation factor IF-2 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=infB PE=3 SV=1 475 1081 8.0E-107
sp|Q21H61|IF2_SACD2 Translation initiation factor IF-2 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=infB PE=3 SV=1 559 1081 1.0E-106
sp|B1MZH4|IF2_LEUCK Translation initiation factor IF-2 OS=Leuconostoc citreum (strain KM20) GN=infB PE=3 SV=1 490 1083 2.0E-106
sp|Q39H30|IF2_BURL3 Translation initiation factor IF-2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=infB PE=3 SV=1 551 1083 2.0E-106
sp|Q1GVI9|IF2_SPHAL Translation initiation factor IF-2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=infB PE=3 SV=1 551 1081 3.0E-106
sp|Q1LSK8|IF2_BAUCH Translation initiation factor IF-2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=infB PE=3 SV=1 555 1083 3.0E-106
sp|Q1LLR6|IF2_CUPMC Translation initiation factor IF-2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=infB PE=3 SV=1 551 1083 3.0E-106
sp|Q46ZP1|IF2_CUPPJ Translation initiation factor IF-2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=infB PE=3 SV=1 551 1083 4.0E-106
sp|B6ENE2|IF2_ALISL Translation initiation factor IF-2 OS=Aliivibrio salmonicida (strain LFI1238) GN=infB PE=3 SV=1 555 1081 5.0E-106
sp|A9MP36|IF2_SALAR Translation initiation factor IF-2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=infB PE=3 SV=1 504 1081 5.0E-106
sp|B5YHT8|IF2_THEYD Translation initiation factor IF-2 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=infB PE=3 SV=1 555 1084 6.0E-106
sp|B5BGJ5|IF2_SALPK Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain AKU_12601) GN=infB PE=3 SV=1 504 1081 6.0E-106
sp|Q5PLB0|IF2_SALPA Translation initiation factor IF-2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=infB PE=3 SV=1 504 1081 6.0E-106
sp|Q7MYY7|IF2_PHOLL Translation initiation factor IF-2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=infB PE=3 SV=1 550 1081 7.0E-106
sp|Q57JH9|IF2_SALCH Translation initiation factor IF-2 OS=Salmonella choleraesuis (strain SC-B67) GN=infB PE=3 SV=1 504 1081 8.0E-106
sp|A5EWY9|IF2_DICNV Translation initiation factor IF-2 OS=Dichelobacter nodosus (strain VCS1703A) GN=infB PE=3 SV=1 554 1081 8.0E-106
sp|Q2IPZ7|IF2_ANADE Translation initiation factor IF-2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=infB PE=3 SV=1 555 1083 8.0E-106
sp|A1JIW9|IF2_YERE8 Translation initiation factor IF-2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=infB PE=3 SV=1 550 1081 1.0E-105
sp|Q9ZF31|IF2_SALTY Translation initiation factor IF-2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=infB PE=3 SV=2 504 1081 1.0E-105
sp|C0PZ54|IF2_SALPC Translation initiation factor IF-2 OS=Salmonella paratyphi C (strain RKS4594) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|A9N732|IF2_SALPB Translation initiation factor IF-2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B4T6Z8|IF2_SALNS Translation initiation factor IF-2 OS=Salmonella newport (strain SL254) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B4TJ06|IF2_SALHS Translation initiation factor IF-2 OS=Salmonella heidelberg (strain SL476) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B5QZV8|IF2_SALEP Translation initiation factor IF-2 OS=Salmonella enteritidis PT4 (strain P125109) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B5FI13|IF2_SALDC Translation initiation factor IF-2 OS=Salmonella dublin (strain CT_02021853) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B5F6T8|IF2_SALA4 Translation initiation factor IF-2 OS=Salmonella agona (strain SL483) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B4TWD8|IF2_SALSV Translation initiation factor IF-2 OS=Salmonella schwarzengrund (strain CVM19633) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|B5REN6|IF2_SALG2 Translation initiation factor IF-2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=infB PE=3 SV=1 504 1081 1.0E-105
sp|A1ST45|IF2_PSYIN Translation initiation factor IF-2 OS=Psychromonas ingrahamii (strain 37) GN=infB PE=3 SV=1 516 1081 1.0E-105
sp|Q8DBW0|IF2_VIBVU Translation initiation factor IF-2 OS=Vibrio vulnificus (strain CMCP6) GN=infB PE=3 SV=1 557 1081 1.0E-105
sp|Q2NC10|IF2_ERYLH Translation initiation factor IF-2 OS=Erythrobacter litoralis (strain HTCC2594) GN=infB PE=3 SV=1 551 1088 2.0E-105
sp|A7H9F3|IF2_ANADF Translation initiation factor IF-2 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=infB PE=3 SV=1 555 1095 2.0E-105
sp|C3LSP8|IF2_VIBCM Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=infB PE=3 SV=1 561 1081 2.0E-105
sp|Q9KU80|IF2_VIBCH Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=infB PE=3 SV=1 561 1081 2.0E-105
sp|A5F926|IF2_VIBC3 Translation initiation factor IF-2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=infB PE=3 SV=1 561 1081 2.0E-105
sp|A9R5A3|IF2_YERPG Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=infB PE=3 SV=1 550 1081 2.0E-105
sp|Q47D94|IF2_DECAR Translation initiation factor IF-2 OS=Dechloromonas aromatica (strain RCB) GN=infB PE=3 SV=1 551 1084 2.0E-105
sp|A1V3N4|IF2_BURMS Translation initiation factor IF-2 OS=Burkholderia mallei (strain SAVP1) GN=infB PE=3 SV=1 551 1083 3.0E-105
sp|Q62KK9|IF2_BURMA Translation initiation factor IF-2 OS=Burkholderia mallei (strain ATCC 23344) GN=infB PE=3 SV=1 551 1083 3.0E-105
sp|A2S2L1|IF2_BURM9 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10229) GN=infB PE=3 SV=1 551 1083 3.0E-105
sp|A3MJW4|IF2_BURM7 Translation initiation factor IF-2 OS=Burkholderia mallei (strain NCTC 10247) GN=infB PE=3 SV=1 551 1083 3.0E-105
sp|B5XSX4|IF2_KLEP3 Translation initiation factor IF-2 OS=Klebsiella pneumoniae (strain 342) GN=infB PE=3 SV=1 551 1081 3.0E-105
sp|B5FA79|IF2_VIBFM Translation initiation factor IF-2 OS=Vibrio fischeri (strain MJ11) GN=infB PE=3 SV=1 555 1081 3.0E-105
sp|A6TEI7|IF2_KLEP7 Translation initiation factor IF-2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=infB PE=3 SV=1 551 1081 3.0E-105
sp|B1JLY0|IF2_YERPY Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=infB PE=3 SV=1 550 1081 4.0E-105
sp|Q66F60|IF2_YERPS Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=infB PE=3 SV=1 550 1081 4.0E-105
sp|A4TRI3|IF2_YERPP Translation initiation factor IF-2 OS=Yersinia pestis (strain Pestoides F) GN=infB PE=3 SV=1 550 1081 4.0E-105
sp|Q1CEL3|IF2_YERPN Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=infB PE=3 SV=1 550 1081 4.0E-105
sp|Q8ZBC2|IF2_YERPE Translation initiation factor IF-2 OS=Yersinia pestis GN=infB PE=3 SV=2 550 1081 4.0E-105
sp|B2K2Q5|IF2_YERPB Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=infB PE=3 SV=1 550 1081 4.0E-105
sp|A7FMS2|IF2_YERP3 Translation initiation factor IF-2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=infB PE=3 SV=1 550 1081 4.0E-105
sp|Q13EL8|IF2_RHOPS Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisB5) GN=infB PE=3 SV=1 551 1084 5.0E-105
sp|Q8Z3H7|IF2_SALTI Translation initiation factor IF-2 OS=Salmonella typhi GN=infB PE=3 SV=1 504 1081 5.0E-105
sp|Q5NZS1|IF2_AROAE Translation initiation factor IF-2 OS=Aromatoleum aromaticum (strain EbN1) GN=infB PE=3 SV=1 551 1083 5.0E-105
sp|Q83JF9|IF2_SHIFL Translation initiation factor IF-2 OS=Shigella flexneri GN=infB PE=3 SV=1 551 1081 5.0E-105
sp|Q31W47|IF2_SHIBS Translation initiation factor IF-2 OS=Shigella boydii serotype 4 (strain Sb227) GN=infB PE=3 SV=1 551 1081 5.0E-105
sp|B7LR37|IF2_ESCF3 Translation initiation factor IF-2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=infB PE=3 SV=1 551 1081 5.0E-105
sp|Q32BG5|IF2_SHIDS Translation initiation factor IF-2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=infB PE=3 SV=1 551 1081 5.0E-105
sp|Q2SVG8|IF2_BURTA Translation initiation factor IF-2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=infB PE=3 SV=1 551 1083 5.0E-105
sp|B1LFS0|IF2_ECOSM Translation initiation factor IF-2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|Q1R6H0|IF2_ECOUT Translation initiation factor IF-2 OS=Escherichia coli (strain UTI89 / UPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B6I1P3|IF2_ECOSE Translation initiation factor IF-2 OS=Escherichia coli (strain SE11) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B7NDF4|IF2_ECOLU Translation initiation factor IF-2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|P0A705|IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) GN=infB PE=1 SV=1 551 1081 6.0E-105
sp|B1IQV3|IF2_ECOLC Translation initiation factor IF-2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|P59587|IF2_ECOL6 Translation initiation factor IF-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|Q0TCU1|IF2_ECOL5 Translation initiation factor IF-2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|A1AG73|IF2_ECOK1 Translation initiation factor IF-2 OS=Escherichia coli O1:K1 / APEC GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|A8A4Y4|IF2_ECOHS Translation initiation factor IF-2 OS=Escherichia coli O9:H4 (strain HS) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B1XGY0|IF2_ECODH Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / DH10B) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|C4ZSQ9|IF2_ECOBW Translation initiation factor IF-2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B7M076|IF2_ECO8A Translation initiation factor IF-2 OS=Escherichia coli O8 (strain IAI1) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B7NKN7|IF2_ECO7I Translation initiation factor IF-2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B5YS58|IF2_ECO5E Translation initiation factor IF-2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|P0A706|IF2_ECO57 Translation initiation factor IF-2 OS=Escherichia coli O157:H7 GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B7LHN3|IF2_ECO55 Translation initiation factor IF-2 OS=Escherichia coli (strain 55989 / EAEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B7MB89|IF2_ECO45 Translation initiation factor IF-2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B7UJ63|IF2_ECO27 Translation initiation factor IF-2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|A7ZS65|IF2_ECO24 Translation initiation factor IF-2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|B2U207|IF2_SHIB3 Translation initiation factor IF-2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|Q3YX73|IF2_SHISS Translation initiation factor IF-2 OS=Shigella sonnei (strain Ss046) GN=infB PE=3 SV=1 551 1081 6.0E-105
sp|Q0T0B3|IF2_SHIF8 Translation initiation factor IF-2 OS=Shigella flexneri serotype 5b (strain 8401) GN=infB PE=3 SV=1 555 1081 6.0E-105
sp|A1K7B9|IF2_AZOSB Translation initiation factor IF-2 OS=Azoarcus sp. (strain BH72) GN=infB PE=3 SV=1 551 1084 7.0E-105
sp|B7N0V3|IF2_ECO81 Translation initiation factor IF-2 OS=Escherichia coli O81 (strain ED1a) GN=infB PE=3 SV=1 551 1081 7.0E-105
sp|A3NUL0|IF2_BURP0 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1106a) GN=infB PE=3 SV=1 551 1083 7.0E-105
sp|Q7MI09|IF2_VIBVY Translation initiation factor IF-2 OS=Vibrio vulnificus (strain YJ016) GN=infB PE=3 SV=1 557 1081 8.0E-105
sp|Q1CC07|IF2_YERPA Translation initiation factor IF-2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=infB PE=3 SV=1 550 1081 9.0E-105
sp|A0K6X5|IF2_BURCH Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain HI2424) GN=infB PE=3 SV=1 551 1083 9.0E-105
sp|Q1BWS7|IF2_BURCA Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain AU 1054) GN=infB PE=3 SV=1 551 1083 9.0E-105
sp|Q5X1C3|IF2_LEGPA Translation initiation factor IF-2 OS=Legionella pneumophila (strain Paris) GN=infB PE=3 SV=1 554 1081 9.0E-105
sp|Q63TP8|IF2_BURPS Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain K96243) GN=infB PE=3 SV=1 551 1083 9.0E-105
sp|A3N8V8|IF2_BURP6 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 668) GN=infB PE=3 SV=1 551 1083 9.0E-105
sp|Q3JSY9|IF2_BURP1 Translation initiation factor IF-2 OS=Burkholderia pseudomallei (strain 1710b) GN=infB PE=3 SV=1 551 1083 9.0E-105
sp|A4JDX1|IF2_BURVG Translation initiation factor IF-2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=infB PE=3 SV=1 551 1083 1.0E-104
sp|Q140U6|IF2_BURXL Translation initiation factor IF-2 OS=Burkholderia xenovorans (strain LB400) GN=infB PE=3 SV=1 551 1083 1.0E-104
sp|Q07V78|IF2_RHOP5 Translation initiation factor IF-2 OS=Rhodopseudomonas palustris (strain BisA53) GN=infB PE=3 SV=1 551 1084 1.0E-104
sp|B1K0M0|IF2_BURCC Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain MC0-3) GN=infB PE=3 SV=1 551 1083 1.0E-104
sp|Q0BFY3|IF2_BURCM Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=infB PE=3 SV=1 551 1083 1.0E-104
sp|B7VJH7|IF2_VIBTL Translation initiation factor IF-2 OS=Vibrio tasmaniensis (strain LGP32) GN=infB PE=3 SV=1 557 1081 1.0E-104
sp|A9ABD5|IF2_BURM1 Translation initiation factor IF-2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=infB PE=3 SV=1 551 1083 1.0E-104
sp|A5IHU7|IF2_LEGPC Translation initiation factor IF-2 OS=Legionella pneumophila (strain Corby) GN=infB PE=3 SV=1 554 1081 1.0E-104
sp|B4E7L1|IF2_BURCJ Translation initiation factor IF-2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=infB PE=3 SV=1 551 1083 2.0E-104
sp|Q0A797|IF2_ALKEH Translation initiation factor IF-2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=infB PE=3 SV=1 553 1081 2.0E-104
sp|Q3SWP9|IF2_NITWN Translation initiation factor IF-2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=infB PE=3 SV=1 551 1084 2.0E-104
sp|A5GVG4|IF2_SYNR3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain RCC307) GN=infB PE=3 SV=1 631 1084 2.0E-104
sp|B4RXT8|IF2_ALTMD Translation initiation factor IF-2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=infB PE=3 SV=1 555 1081 2.0E-104
sp|A7MZI5|IF2_VIBCB Translation initiation factor IF-2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=infB PE=3 SV=1 555 1081 2.0E-104
sp|Q5E7L5|IF2_VIBF1 Translation initiation factor IF-2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=infB PE=3 SV=1 555 1081 2.0E-104
sp|C0QHM2|IF2_DESAH Translation initiation factor IF-2 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=infB PE=3 SV=1 515 1083 2.0E-104
sp|Q12AU7|IF2_POLSJ Translation initiation factor IF-2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=infB PE=3 SV=1 559 1084 3.0E-104
sp|Q5WT36|IF2_LEGPL Translation initiation factor IF-2 OS=Legionella pneumophila (strain Lens) GN=infB PE=3 SV=1 554 1081 3.0E-104
sp|B1YP36|IF2_BURA4 Translation initiation factor IF-2 OS=Burkholderia ambifaria (strain MC40-6) GN=infB PE=3 SV=1 551 1083 3.0E-104
sp|C5CLW3|IF2_VARPS Translation initiation factor IF-2 OS=Variovorax paradoxus (strain S110) GN=infB PE=3 SV=1 550 1081 3.0E-104
sp|A0LE19|IF2_MAGMM Translation initiation factor IF-2 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=infB PE=3 SV=1 555 1083 3.0E-104
sp|Q0K9B9|IF2_CUPNH Translation initiation factor IF-2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=infB PE=3 SV=1 551 1083 4.0E-104
sp|Q5ZRV4|IF2_LEGPH Translation initiation factor IF-2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=infB PE=3 SV=1 554 1081 4.0E-104
sp|Q8RA37|IF2_CALS4 Translation initiation factor IF-2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=infB PE=3 SV=1 545 1083 4.0E-104
sp|B2T381|IF2_BURPP Translation initiation factor IF-2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=infB PE=3 SV=1 551 1083 5.0E-104
sp|Q9ZF22|IF2_PROVU Translation initiation factor IF-2 OS=Proteus vulgaris GN=infB PE=3 SV=1 555 1081 6.0E-104
sp|A4SY78|IF2_POLSQ Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=infB PE=3 SV=1 551 1084 9.0E-104
sp|Q2RJM5|IF2_MOOTA Translation initiation factor IF-2 OS=Moorella thermoacetica (strain ATCC 39073) GN=infB PE=3 SV=1 557 1083 1.0E-103
sp|B2JKT4|IF2_BURP8 Translation initiation factor IF-2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=infB PE=3 SV=1 551 1083 1.0E-103
sp|B8I6E7|IF2_CLOCE Translation initiation factor IF-2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=infB PE=3 SV=1 556 1083 1.0E-103
sp|B8FCY5|IF2_DESAA Translation initiation factor IF-2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=infB PE=3 SV=1 555 1083 1.0E-103
sp|Q2G5E7|IF2_NOVAD Translation initiation factor IF-2 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=infB PE=3 SV=1 532 1081 2.0E-103
sp|Q3IJ53|IF2_PSEHT Translation initiation factor IF-2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=infB PE=3 SV=1 557 1081 2.0E-103
sp|Q3J9B6|IF2_NITOC Translation initiation factor IF-2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=infB PE=3 SV=1 559 1081 2.0E-103
sp|B4F2B9|IF2_PROMH Translation initiation factor IF-2 OS=Proteus mirabilis (strain HI4320) GN=infB PE=3 SV=1 555 1081 2.0E-103
sp|Q1GXD6|IF2_METFK Translation initiation factor IF-2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=infB PE=3 SV=1 551 1084 3.0E-103
sp|Q4FVL5|IF2_PSYA2 Translation initiation factor IF-2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=infB PE=3 SV=1 550 1081 3.0E-103
sp|A1WXV1|IF2_HALHL Translation initiation factor IF-2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=infB PE=3 SV=1 555 1081 3.0E-103
sp|Q87M02|IF2_VIBPA Translation initiation factor IF-2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=infB PE=3 SV=1 555 1081 3.0E-103
sp|A5WBS5|IF2_PSYWF Translation initiation factor IF-2 OS=Psychrobacter sp. (strain PRwf-1) GN=infB PE=3 SV=1 550 1081 4.0E-103
sp|B3R1E4|IF2_CUPTR Translation initiation factor IF-2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=infB PE=3 SV=1 551 1083 4.0E-103
sp|B8GP02|IF2_THISH Translation initiation factor IF-2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=infB PE=3 SV=1 553 1081 4.0E-103
sp|Q6D9A5|IF2_PECAS Translation initiation factor IF-2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=infB PE=3 SV=1 504 1081 4.0E-103
sp|Q01W31|IF2_SOLUE Translation initiation factor IF-2 OS=Solibacter usitatus (strain Ellin6076) GN=infB PE=3 SV=1 526 1084 5.0E-103
sp|A9ITX6|IF2_BORPD Translation initiation factor IF-2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=infB PE=3 SV=1 551 1095 5.0E-103
sp|Q2KXY7|IF2_BORA1 Translation initiation factor IF-2 OS=Bordetella avium (strain 197N) GN=infB PE=3 SV=1 551 1084 6.0E-103
sp|O83861|IF2_TREPA Translation initiation factor IF-2 OS=Treponema pallidum (strain Nichols) GN=infB PE=3 SV=1 515 1083 7.0E-103
sp|Q15V72|IF2_PSEA6 Translation initiation factor IF-2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=infB PE=3 SV=1 555 1081 1.0E-102
sp|B8J1Y4|IF2_DESDA Translation initiation factor IF-2 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=infB PE=3 SV=1 550 1083 1.0E-102
sp|A1WLI3|IF2_VEREI Translation initiation factor IF-2 OS=Verminephrobacter eiseniae (strain EF01-2) GN=infB PE=3 SV=1 559 1082 2.0E-102
sp|Q1QEP5|IF2_PSYCK Translation initiation factor IF-2 OS=Psychrobacter cryohalolentis (strain K5) GN=infB PE=3 SV=1 550 1081 2.0E-102
sp|C0QTL9|IF2_PERMH Translation initiation factor IF-2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=infB PE=3 SV=1 558 1083 2.0E-102
sp|B4S4S6|IF2_PROA2 Translation initiation factor IF-2 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=infB PE=3 SV=1 591 1083 2.0E-102
sp|Q6FF40|IF2_ACIAD Translation initiation factor IF-2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=infB PE=3 SV=1 563 1081 2.0E-102
sp|Q7VYR2|IF2_BORPE Translation initiation factor IF-2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=infB PE=3 SV=1 551 1084 3.0E-102
sp|A1AMM1|IF2_PELPD Translation initiation factor IF-2 OS=Pelobacter propionicus (strain DSM 2379) GN=infB PE=3 SV=1 537 1083 3.0E-102
sp|B1XV89|IF2_POLNS Translation initiation factor IF-2 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=infB PE=3 SV=1 550 1084 3.0E-102
sp|A2C6Q5|IF2_PROM3 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9303) GN=infB PE=3 SV=1 557 1084 4.0E-102
sp|Q7V5M4|IF2_PROMM Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9313) GN=infB PE=3 SV=1 557 1084 4.0E-102
sp|Q7W9A5|IF2_BORPA Translation initiation factor IF-2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=infB PE=3 SV=1 551 1084 4.0E-102
sp|Q73NP6|IF2_TREDE Translation initiation factor IF-2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=infB PE=3 SV=1 546 1083 5.0E-102
sp|Q74CT3|IF2_GEOSL Translation initiation factor IF-2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=infB PE=3 SV=1 555 1083 6.0E-102
sp|C6DKK3|IF2_PECCP Translation initiation factor IF-2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=infB PE=3 SV=1 550 1081 6.0E-102
sp|Q7NY13|IF2_CHRVO Translation initiation factor IF-2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=infB PE=3 SV=1 551 1095 7.0E-102
sp|Q8KFT1|IF2_CHLTE Translation initiation factor IF-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=infB PE=3 SV=1 557 1083 8.0E-102
sp|A9BCI5|IF2_PROM4 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9211) GN=infB PE=3 SV=1 525 1083 9.0E-102
sp|B1XY67|IF2_LEPCP Translation initiation factor IF-2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=infB PE=3 SV=1 559 1081 9.0E-102
sp|B3EAE7|IF2_GEOLS Translation initiation factor IF-2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=infB PE=3 SV=1 537 1083 1.0E-101
sp|Q2NW23|IF2_SODGM Translation initiation factor IF-2 OS=Sodalis glossinidius (strain morsitans) GN=infB PE=3 SV=1 551 1081 1.0E-101
sp|Q7WHG2|IF2_BORBR Translation initiation factor IF-2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=infB PE=3 SV=1 551 1084 1.0E-101
sp|B0S1E5|IF2_FINM2 Translation initiation factor IF-2 OS=Finegoldia magna (strain ATCC 29328) GN=infB PE=3 SV=1 555 1083 2.0E-101
sp|C4K3F0|IF2_HAMD5 Translation initiation factor IF-2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=infB PE=3 SV=1 555 1081 2.0E-101
sp|A1TSK3|IF2_ACIAC Translation initiation factor IF-2 OS=Acidovorax citrulli (strain AAC00-1) GN=infB PE=3 SV=1 538 1081 2.0E-101
sp|B2UAA3|IF2_RALPJ Translation initiation factor IF-2 OS=Ralstonia pickettii (strain 12J) GN=infB PE=3 SV=1 551 1083 2.0E-101
sp|Q8K9H1|IF2_BUCAP Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=infB PE=3 SV=1 555 1081 2.0E-101
sp|B0VE81|IF2_ACIBY Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AYE) GN=infB PE=3 SV=1 563 1081 3.0E-101
sp|B2I2M7|IF2_ACIBC Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain ACICU) GN=infB PE=3 SV=1 563 1081 3.0E-101
sp|B7I3R9|IF2_ACIB5 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB0057) GN=infB PE=3 SV=1 563 1081 3.0E-101
sp|B7H115|IF2_ACIB3 Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain AB307-0294) GN=infB PE=3 SV=1 563 1081 3.0E-101
sp|Q0AFJ3|IF2_NITEC Translation initiation factor IF-2 OS=Nitrosomonas eutropha (strain C91) GN=infB PE=3 SV=1 511 1084 3.0E-101
sp|Q609C0|IF2_METCA Translation initiation factor IF-2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=infB PE=3 SV=1 557 1081 4.0E-101
sp|Q7VA20|IF2_PROMA Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=infB PE=3 SV=1 536 1083 4.0E-101
sp|B0VLU2|IF2_ACIBS Translation initiation factor IF-2 OS=Acinetobacter baumannii (strain SDF) GN=infB PE=3 SV=1 563 1081 4.0E-101
sp|A5CEN6|IF2_ORITB Translation initiation factor IF-2 OS=Orientia tsutsugamushi (strain Boryong) GN=infB PE=3 SV=1 549 1083 4.0E-101
sp|A8G6Z5|IF2_PROM2 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9215) GN=infB PE=3 SV=1 536 1083 4.0E-101
sp|A5D2S0|IF2_PELTS Translation initiation factor IF-2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=infB PE=3 SV=1 555 1095 4.0E-101
sp|Q5NQ27|IF2_ZYMMO Translation initiation factor IF-2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=infB PE=3 SV=1 555 1082 4.0E-101
sp|A6VU29|IF2_MARMS Translation initiation factor IF-2 OS=Marinomonas sp. (strain MWYL1) GN=infB PE=3 SV=1 557 1081 4.0E-101
sp|A1AV99|IF2_RUTMC Translation initiation factor IF-2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=infB PE=3 SV=1 550 1095 5.0E-101
sp|Q11PK5|IF2_CYTH3 Translation initiation factor IF-2 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=infB PE=3 SV=1 544 1083 5.0E-101
sp|Q318P8|IF2_PROM9 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9312) GN=infB PE=3 SV=1 536 1083 6.0E-101
sp|B0K9Q0|IF2_THEP3 Translation initiation factor IF-2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=infB PE=3 SV=1 551 1083 6.0E-101
sp|Q18BH4|IF2_PEPD6 Translation initiation factor IF-2 OS=Peptoclostridium difficile (strain 630) GN=infB PE=3 SV=1 563 1084 7.0E-101
sp|B0K1D6|IF2_THEPX Translation initiation factor IF-2 OS=Thermoanaerobacter sp. (strain X514) GN=infB PE=3 SV=1 559 1083 9.0E-101
sp|Q3SKX1|IF2_THIDA Translation initiation factor IF-2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=infB PE=3 SV=1 537 1084 9.0E-101
sp|A1W8Z4|IF2_ACISJ Translation initiation factor IF-2 OS=Acidovorax sp. (strain JS42) GN=infB PE=3 SV=1 557 1081 9.0E-101
sp|Q3AB98|IF2_CARHZ Translation initiation factor IF-2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=infB PE=3 SV=1 550 1081 1.0E-100
sp|Q04U31|IF2_LEPBJ Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=infB PE=3 SV=1 537 1095 1.0E-100
sp|A2BYM0|IF2_PROM5 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9515) GN=infB PE=3 SV=1 536 1083 1.0E-100
sp|A0LHL8|IF2_SYNFM Translation initiation factor IF-2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=infB PE=3 SV=1 600 1083 1.0E-100
sp|Q7UZZ9|IF2_PROMP Translation initiation factor IF-2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=infB PE=3 SV=1 536 1083 1.0E-100
sp|Q7U8L9|IF2_SYNPX Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH8102) GN=infB PE=3 SV=1 557 1083 2.0E-100
sp|B8D7R4|IF2_BUCAT Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=infB PE=3 SV=1 555 1081 2.0E-100
sp|C1CCT8|IF2_STRZJ Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain JJA) GN=infB PE=3 SV=1 563 1083 2.0E-100
sp|Q8DQV2|IF2_STRR6 Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=infB PE=3 SV=1 563 1083 2.0E-100
sp|Q04LW0|IF2_STRP2 Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=infB PE=3 SV=1 563 1083 2.0E-100
sp|C1CQ48|IF2_STRZT Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=infB PE=3 SV=1 563 1083 2.0E-100
sp|C1C5S8|IF2_STRP7 Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain 70585) GN=infB PE=3 SV=1 563 1083 2.0E-100
sp|Q04ZJ5|IF2_LEPBL Translation initiation factor IF-2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=infB PE=3 SV=1 537 1095 2.0E-100
sp|B5E266|IF2_STRP4 Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=infB PE=3 SV=1 563 1083 2.0E-100
sp|B5EI57|IF2_GEOBB Translation initiation factor IF-2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=infB PE=3 SV=1 515 1083 2.0E-100
sp|C1FS59|IF2_CLOBJ Translation initiation factor IF-2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=infB PE=3 SV=1 635 1083 2.0E-100
sp|Q1AW55|IF2_RUBXD Translation initiation factor IF-2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=infB PE=3 SV=1 564 1083 3.0E-100
sp|B2IME4|IF2_STRPS Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain CGSP14) GN=infB PE=3 SV=1 563 1083 3.0E-100
sp|Q03WH4|IF2_LEUMM Translation initiation factor IF-2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=infB PE=3 SV=1 490 1083 3.0E-100
sp|P57458|IF2_BUCAI Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=infB PE=3 SV=1 555 1081 3.0E-100
sp|B8D9G2|IF2_BUCA5 Translation initiation factor IF-2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=infB PE=3 SV=1 555 1081 3.0E-100
sp|Q2GGQ8|IF2_EHRCR Translation initiation factor IF-2 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=infB PE=3 SV=2 532 1082 3.0E-100
sp|A2BT70|IF2_PROMS Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain AS9601) GN=infB PE=3 SV=1 536 1083 3.0E-100
sp|Q97S57|IF2_STRPN Translation initiation factor IF-2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=infB PE=3 SV=1 563 1083 3.0E-100
sp|Q1QSZ0|IF2_CHRSD Translation initiation factor IF-2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=infB PE=3 SV=1 555 1081 3.0E-100
sp|B1KWK7|IF2_CLOBM Translation initiation factor IF-2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=infB PE=3 SV=1 635 1083 4.0E-100
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=infB PE=3 SV=1 635 1083 4.0E-100
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=infB PE=3 SV=1 635 1083 4.0E-100
sp|C1CJ39|IF2_STRZP Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain P1031) GN=infB PE=3 SV=1 563 1083 4.0E-100
sp|A3PEY3|IF2_PROM0 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain MIT 9301) GN=infB PE=3 SV=1 536 1083 4.0E-100
sp|A1VNU2|IF2_POLNA Translation initiation factor IF-2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=infB PE=3 SV=1 559 1084 4.0E-100
sp|A5N842|IF2_CLOK5 Translation initiation factor IF-2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=infB PE=3 SV=1 533 1083 4.0E-100
sp|Q2Y7W2|IF2_NITMU Translation initiation factor IF-2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=infB PE=3 SV=1 551 1084 4.0E-100
sp|B1HR05|IF2_LYSSC Translation initiation factor IF-2 OS=Lysinibacillus sphaericus (strain C3-41) GN=infB PE=3 SV=1 546 1083 4.0E-100
sp|B9EBE9|IF2_MACCJ Translation initiation factor IF-2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=infB PE=3 SV=1 549 1083 5.0E-100
sp|B1II49|IF2_CLOBK Translation initiation factor IF-2 OS=Clostridium botulinum (strain Okra / Type B1) GN=infB PE=3 SV=1 635 1083 5.0E-100
sp|Q5PAJ5|IF2_ANAMM Translation initiation factor IF-2 OS=Anaplasma marginale (strain St. Maries) GN=infB PE=3 SV=1 554 1082 5.0E-100
sp|Q46J13|IF2_PROMT Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL2A) GN=infB PE=3 SV=1 529 1083 6.0E-100
sp|C3L0B6|IF2_CLOB6 Translation initiation factor IF-2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=infB PE=3 SV=1 635 1083 6.0E-100
sp|Q39VA6|IF2_GEOMG Translation initiation factor IF-2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=infB PE=3 SV=1 555 1083 7.0E-100
sp|Q10XM3|IF2_TRIEI Translation initiation factor IF-2 OS=Trichodesmium erythraeum (strain IMS101) GN=infB PE=3 SV=1 631 1084 7.0E-100
sp|B9DPF5|IF2_STACT Translation initiation factor IF-2 OS=Staphylococcus carnosus (strain TM300) GN=infB PE=3 SV=1 547 1083 8.0E-100
sp|C6E2Q0|IF2_GEOSM Translation initiation factor IF-2 OS=Geobacter sp. (strain M21) GN=infB PE=3 SV=1 515 1083 8.0E-100
sp|Q3YS01|IF2_EHRCJ Translation initiation factor IF-2 OS=Ehrlichia canis (strain Jake) GN=infB PE=3 SV=1 532 1082 9.0E-100
sp|Q8XZV6|IF2_RALSO Translation initiation factor IF-2 OS=Ralstonia solanacearum (strain GMI1000) GN=infB PE=3 SV=1 551 1083 9.0E-100
sp|B1IA80|IF2_STRPI Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=infB PE=3 SV=1 563 1083 9.0E-100
sp|Q6LUJ2|IF2_PHOPR Translation initiation factor IF-2 OS=Photobacterium profundum GN=infB PE=3 SV=1 557 1081 9.0E-100
sp|Q835U8|IF2_ENTFA Translation initiation factor IF-2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=infB PE=3 SV=1 561 1083 1.0E-99
sp|A8FDD1|IF2_BACP2 Translation initiation factor IF-2 OS=Bacillus pumilus (strain SAFR-032) GN=infB PE=3 SV=1 559 1083 1.0E-99
sp|A5CXX6|IF2_VESOH Translation initiation factor IF-2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=infB PE=3 SV=1 486 1095 1.0E-99
sp|C1D8X2|IF2_LARHH Translation initiation factor IF-2 OS=Laribacter hongkongensis (strain HLHK9) GN=infB PE=3 SV=1 551 1084 1.0E-99
sp|C5D9C9|IF2_GEOSW Translation initiation factor IF-2 OS=Geobacillus sp. (strain WCH70) GN=infB PE=3 SV=1 546 1084 1.0E-99
sp|B2FN90|IF2_STRMK Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain K279a) GN=infB PE=3 SV=1 555 1081 1.0E-99
sp|B8CW72|IF2_HALOH Translation initiation factor IF-2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=infB PE=3 SV=1 619 1083 2.0E-99
sp|A5VCZ5|IF2_SPHWW Translation initiation factor IF-2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=infB PE=3 SV=1 555 1082 2.0E-99
sp|Q24UI6|IF2_DESHY Translation initiation factor IF-2 OS=Desulfitobacterium hafniense (strain Y51) GN=infB PE=3 SV=1 547 1083 2.0E-99
sp|A8MFA8|IF2_ALKOO Translation initiation factor IF-2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=infB PE=3 SV=1 557 1092 3.0E-99
sp|Q5M5V5|IF2_STRT2 Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=infB PE=3 SV=1 561 1083 3.0E-99
sp|A9HF18|IF2_GLUDA Translation initiation factor IF-2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=infB PE=3 SV=1 555 1084 3.0E-99
sp|Q493T7|IF2_BLOPB Translation initiation factor IF-2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=infB PE=3 SV=1 550 1081 3.0E-99
sp|Q5M1B9|IF2_STRT1 Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=infB PE=3 SV=1 561 1083 3.0E-99
sp|Q67P86|IF2_SYMTH Translation initiation factor IF-2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=infB PE=3 SV=1 482 1083 4.0E-99
sp|B4SQS0|IF2_STRM5 Translation initiation factor IF-2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=infB PE=3 SV=1 555 1081 4.0E-99
sp|B8ZM93|IF2_STRPJ Translation initiation factor IF-2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=infB PE=3 SV=1 563 1083 4.0E-99
sp|Q0AYI8|IF2_SYNWW Translation initiation factor IF-2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=infB PE=3 SV=1 539 1083 4.0E-99
sp|Q03M88|IF2_STRTD Translation initiation factor IF-2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=infB PE=3 SV=1 561 1083 5.0E-99
sp|B4RMZ3|IF2_NEIG2 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=infB PE=3 SV=1 551 1095 6.0E-99
sp|Q8CST4|IF2_STAES Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=infB PE=3 SV=1 557 1083 6.0E-99
sp|Q5HPS2|IF2_STAEQ Translation initiation factor IF-2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=infB PE=3 SV=1 557 1083 6.0E-99
sp|Q0I7K2|IF2_SYNS3 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9311) GN=infB PE=3 SV=1 631 1084 6.0E-99
sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=infB PE=3 SV=1 635 1083 6.0E-99
sp|Q5L0I8|IF2_GEOKA Translation initiation factor IF-2 OS=Geobacillus kaustophilus (strain HTA426) GN=infB PE=3 SV=1 546 1084 7.0E-99
sp|A9KNW4|IF2_CLOPH Translation initiation factor IF-2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=infB PE=3 SV=1 631 1081 8.0E-99
sp|A2C4P1|IF2_PROM1 Translation initiation factor IF-2 OS=Prochlorococcus marinus (strain NATL1A) GN=infB PE=3 SV=1 557 1083 9.0E-99
sp|A5GF86|IF2_GEOUR Translation initiation factor IF-2 OS=Geobacter uraniireducens (strain Rf4) GN=infB PE=3 SV=1 551 1083 9.0E-99
sp|B3QQI2|IF2_CHLP8 Translation initiation factor IF-2 OS=Chlorobaculum parvum (strain NCIB 8327) GN=infB PE=3 SV=1 557 1083 1.0E-98
sp|Q9JTB5|IF2_NEIMA Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=infB PE=3 SV=1 551 1095 1.0E-98
sp|B7GG75|IF2_ANOFW Translation initiation factor IF-2 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=infB PE=3 SV=1 563 1084 1.0E-98
sp|Q21WJ5|IF2_RHOFT Translation initiation factor IF-2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=infB PE=3 SV=1 550 1084 2.0E-98
sp|A9M1D5|IF2_NEIM0 Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=infB PE=3 SV=1 551 1095 2.0E-98
sp|Q4FNM9|IF2_PELUB Translation initiation factor IF-2 OS=Pelagibacter ubique (strain HTCC1062) GN=infB PE=3 SV=1 537 1084 2.0E-98
sp|P17889|IF2_BACSU Translation initiation factor IF-2 OS=Bacillus subtilis (strain 168) GN=infB PE=3 SV=1 559 1084 2.0E-98
sp|Q0SSD4|IF2_CLOPS Translation initiation factor IF-2 OS=Clostridium perfringens (strain SM101 / Type A) GN=infB PE=3 SV=1 635 1084 2.0E-98
sp|Q8XJR8|IF2_CLOPE Translation initiation factor IF-2 OS=Clostridium perfringens (strain 13 / Type A) GN=infB PE=3 SV=1 635 1084 2.0E-98
sp|Q0TPR7|IF2_CLOP1 Translation initiation factor IF-2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=infB PE=3 SV=1 635 1084 2.0E-98
sp|A6L030|IF2_BACV8 Translation initiation factor IF-2 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=infB PE=3 SV=1 495 1083 4.0E-98
sp|A5GNJ0|IF2_SYNPW Translation initiation factor IF-2 OS=Synechococcus sp. (strain WH7803) GN=infB PE=3 SV=1 557 1084 5.0E-98
sp|Q97I51|IF2_CLOAB Translation initiation factor IF-2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=infB PE=3 SV=1 637 1084 5.0E-98
sp|P55875|IF2_STIAU Translation initiation factor IF-2 OS=Stigmatella aurantiaca GN=infB PE=3 SV=1 555 1083 5.0E-98
sp|A6Q226|IF2_NITSB Translation initiation factor IF-2 OS=Nitratiruptor sp. (strain SB155-2) GN=infB PE=3 SV=1 555 1083 6.0E-98
sp|Q82WD0|IF2_NITEU Translation initiation factor IF-2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=infB PE=3 SV=1 551 1084 6.0E-98
sp|Q4UWA2|IF2_XANC8 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=infB PE=3 SV=2 555 1081 6.0E-98
sp|A2SH40|IF2_METPP Translation initiation factor IF-2 OS=Methylibium petroleiphilum (strain PM1) GN=infB PE=3 SV=1 551 1081 6.0E-98
sp|A1KV51|IF2_NEIMF Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=infB PE=3 SV=1 551 1095 7.0E-98
sp|B9M1G0|IF2_GEODF Translation initiation factor IF-2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=infB PE=3 SV=1 526 1083 7.0E-98
sp|Q8P7U7|IF2_XANCP Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=infB PE=3 SV=1 555 1081 9.0E-98
sp|A6QBQ5|IF2_SULNB Translation initiation factor IF-2 OS=Sulfurovum sp. (strain NBC37-1) GN=infB PE=3 SV=1 513 1083 9.0E-98
sp|B0RRB4|IF2_XANCB Translation initiation factor IF-2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=infB PE=3 SV=1 555 1081 9.0E-98
sp|Q3B1Z8|IF2_CHLL7 Translation initiation factor IF-2 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=infB PE=3 SV=1 507 1083 1.0E-97
sp|Q8E1H3|IF2_STRA5 Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=infB PE=3 SV=1 561 1083 1.0E-97
sp|O67825|IF2_AQUAE Translation initiation factor IF-2 OS=Aquifex aeolicus (strain VF5) GN=infB PE=3 SV=1 638 1083 1.0E-97
sp|A7Z4T4|IF2_BACMF Translation initiation factor IF-2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=infB PE=3 SV=1 559 1084 1.0E-97
sp|Q5F797|IF2_NEIG1 Translation initiation factor IF-2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=infB PE=3 SV=1 551 1095 1.0E-97
sp|P0A3K7|IF2_STRAG Translation initiation factor IF-2 OS=Streptococcus agalactiae GN=infB PE=3 SV=1 561 1083 1.0E-97
sp|P0A3K6|IF2_STRA3 Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=infB PE=3 SV=1 561 1083 1.0E-97
sp|Q3K302|IF2_STRA1 Translation initiation factor IF-2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=infB PE=3 SV=1 561 1083 1.0E-97
sp|Q65JI1|IF2_BACLD Translation initiation factor IF-2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=infB PE=3 SV=1 635 1083 2.0E-97
sp|Q7MXE4|IF2_PORGI Translation initiation factor IF-2 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=infB PE=3 SV=1 548 1083 2.0E-97
sp|Q3KI84|IF2_PSEPF Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=infB PE=3 SV=1 555 1081 2.0E-97
sp|B3EFB1|IF2_CHLL2 Translation initiation factor IF-2 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=infB PE=3 SV=1 551 1083 2.0E-97
sp|A4XL70|IF2_CALS8 Translation initiation factor IF-2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=infB PE=3 SV=1 559 1081 2.0E-97
sp|A4IMD7|IF2_GEOTN Translation initiation factor IF-2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=infB PE=3 SV=1 535 1084 2.0E-97
sp|Q30WJ0|IF2_DESAG Translation initiation factor IF-2 OS=Desulfovibrio alaskensis (strain G20) GN=infB PE=3 SV=1 555 1083 2.0E-97
sp|Q1MQY8|IF2_LAWIP Translation initiation factor IF-2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=infB PE=3 SV=1 502 1083 2.0E-97
sp|Q3AHW1|IF2_SYNSC Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9605) GN=infB PE=3 SV=1 557 1084 2.0E-97
sp|B2RHM9|IF2_PORG3 Translation initiation factor IF-2 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=infB PE=3 SV=1 548 1083 2.0E-97
sp|A6GWV8|IF2_FLAPJ Translation initiation factor IF-2 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=infB PE=3 SV=1 539 1084 3.0E-97
sp|Q9JYD2|IF2_NEIMB Translation initiation factor IF-2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=infB PE=3 SV=1 551 1095 3.0E-97
sp|B2SVK3|IF2_XANOP Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=infB PE=3 SV=1 555 1081 3.0E-97
sp|Q0VSS1|IF2_ALCBS Translation initiation factor IF-2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=infB PE=3 SV=1 537 1081 3.0E-97
sp|Q2GKQ2|IF2_ANAPZ Translation initiation factor IF-2 OS=Anaplasma phagocytophilum (strain HZ) GN=infB PE=3 SV=1 537 1082 3.0E-97
sp|Q5GXU9|IF2_XANOR Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=infB PE=3 SV=2 555 1081 3.0E-97
sp|Q2P0X1|IF2_XANOM Translation initiation factor IF-2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=infB PE=3 SV=1 555 1081 3.0E-97
sp|Q48E77|IF2_PSE14 Translation initiation factor IF-2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=infB PE=3 SV=1 555 1081 3.0E-97
sp|C1DFK9|IF2_AZOVD Translation initiation factor IF-2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=infB PE=3 SV=1 553 1081 4.0E-97
sp|Q1DAM6|IF2_MYXXD Translation initiation factor IF-2 OS=Myxococcus xanthus (strain DK 1622) GN=infB PE=3 SV=1 555 1095 4.0E-97
sp|P04766|IF2_GEOSE Translation initiation factor IF-2 OS=Geobacillus stearothermophilus GN=infB PE=1 SV=1 535 1084 4.0E-97
sp|A6TRK7|IF2_ALKMQ Translation initiation factor IF-2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=infB PE=3 SV=1 542 1083 4.0E-97
sp|Q8F7K1|IF2_LEPIN Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=infB PE=3 SV=2 555 1095 5.0E-97
sp|Q3Z7U3|IF2_DEHM1 Translation initiation factor IF-2 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=infB PE=3 SV=1 542 1081 5.0E-97
sp|A3DE44|IF2_CLOTH Translation initiation factor IF-2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=infB PE=3 SV=1 556 1081 5.0E-97
sp|Q4KIF6|IF2_PSEF5 Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=infB PE=3 SV=1 553 1081 5.0E-97
sp|Q1IF43|IF2_PSEE4 Translation initiation factor IF-2 OS=Pseudomonas entomophila (strain L48) GN=infB PE=3 SV=1 555 1081 6.0E-97
sp|Q72NX3|IF2_LEPIC Translation initiation factor IF-2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=infB PE=3 SV=2 555 1095 6.0E-97
sp|B3ELN8|IF2_CHLPB Translation initiation factor IF-2 OS=Chlorobium phaeobacteroides (strain BS1) GN=infB PE=3 SV=1 555 1083 6.0E-97
sp|Q4ZNR2|IF2_PSEU2 Translation initiation factor IF-2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=infB PE=3 SV=1 555 1081 8.0E-97
sp|A0Q0Q7|IF2_CLONN Translation initiation factor IF-2 OS=Clostridium novyi (strain NT) GN=infB PE=3 SV=1 637 1083 9.0E-97
sp|Q87WQ5|IF2_PSESM Translation initiation factor IF-2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=infB PE=3 SV=1 555 1081 9.0E-97
sp|Q8D2X6|IF2_WIGBR Translation initiation factor IF-2 OS=Wigglesworthia glossinidia brevipalpis GN=infB PE=3 SV=1 550 1083 1.0E-96
sp|Q4L5X1|IF2_STAHJ Translation initiation factor IF-2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=infB PE=3 SV=1 557 1083 1.0E-96
sp|Q8EQU1|IF2_OCEIH Translation initiation factor IF-2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=infB PE=3 SV=1 563 1083 1.0E-96
sp|Q8Y7F6|IF2_LISMO Translation initiation factor IF-2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=infB PE=3 SV=1 557 1087 1.0E-96
sp|B9DVB7|IF2_STRU0 Translation initiation factor IF-2 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=infB PE=3 SV=1 561 1083 1.0E-96
sp|B8DG02|IF2_LISMH Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=infB PE=3 SV=1 557 1087 2.0E-96
sp|Q3AZB7|IF2_SYNS9 Translation initiation factor IF-2 OS=Synechococcus sp. (strain CC9902) GN=infB PE=3 SV=1 631 1084 2.0E-96
sp|A6T0Y8|IF2_JANMA Translation initiation factor IF-2 OS=Janthinobacterium sp. (strain Marseille) GN=infB PE=3 SV=1 551 1084 2.0E-96
sp|Q71ZZ7|IF2_LISMF Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=infB PE=3 SV=1 557 1087 2.0E-96
sp|C1L2N1|IF2_LISMC Translation initiation factor IF-2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=infB PE=3 SV=1 557 1087 2.0E-96
sp|Q92C29|IF2_LISIN Translation initiation factor IF-2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=infB PE=3 SV=1 557 1087 3.0E-96
sp|B0JU67|IF2_MICAN Translation initiation factor IF-2 OS=Microcystis aeruginosa (strain NIES-843) GN=infB PE=3 SV=1 551 1083 3.0E-96
sp|B1XI09|IF2_SYNP2 Translation initiation factor IF-2 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=infB PE=3 SV=1 557 1083 4.0E-96
sp|Q8A2A1|IF2_BACTN Translation initiation factor IF-2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=infB PE=3 SV=1 546 1083 4.0E-96
sp|A0AIC6|IF2_LISW6 Translation initiation factor IF-2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=infB PE=3 SV=1 557 1087 5.0E-96
sp|B3QUN2|IF2_CHLT3 Translation initiation factor IF-2 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=infB PE=3 SV=1 532 1095 6.0E-96
sp|Q3BRP5|IF2_XANC5 Translation initiation factor IF-2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=infB PE=3 SV=1 555 1081 7.0E-96
sp|Q8PJ55|IF2_XANAC Translation initiation factor IF-2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=infB PE=3 SV=1 555 1081 8.0E-96
sp|A4VXH3|IF2_STRSY Translation initiation factor IF-2 OS=Streptococcus suis (strain 05ZYH33) GN=infB PE=3 SV=1 563 1084 1.0E-95
sp|A4W3R7|IF2_STRS2 Translation initiation factor IF-2 OS=Streptococcus suis (strain 98HAH33) GN=infB PE=3 SV=1 563 1084 1.0E-95
sp|A5W987|IF2_PSEP1 Translation initiation factor IF-2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=infB PE=3 SV=1 555 1081 1.0E-95
sp|Q88DV7|IF2_PSEPK Translation initiation factor IF-2 OS=Pseudomonas putida (strain KT2440) GN=infB PE=3 SV=1 555 1081 1.0E-95
sp|Q8NWZ1|IF2_STAAW Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MW2) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|Q6G9U4|IF2_STAAS Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MSSA476) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|Q6GHG6|IF2_STAAR Translation initiation factor IF-2 OS=Staphylococcus aureus (strain MRSA252) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|A4G7S7|IF2_HERAR Translation initiation factor IF-2 OS=Herminiimonas arsenicoxydans GN=infB PE=3 SV=1 551 1084 1.0E-95
sp|P65134|IF2_STAAN Translation initiation factor IF-2 OS=Staphylococcus aureus (strain N315) GN=infB PE=1 SV=1 561 1083 1.0E-95
sp|P65133|IF2_STAAM Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|Q2YXP7|IF2_STAAB Translation initiation factor IF-2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|A5ISF3|IF2_STAA9 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH9) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|A6U188|IF2_STAA2 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain JH1) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|A7X1Q1|IF2_STAA1 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=infB PE=3 SV=1 561 1083 1.0E-95
sp|A8AVQ2|IF2_STRGC Translation initiation factor IF-2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=infB PE=3 SV=1 563 1084 1.0E-95
sp|A6LSQ4|IF2_CLOB8 Translation initiation factor IF-2 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=infB PE=3 SV=1 563 1083 1.0E-95
sp|Q7VQM3|IF2_BLOFL Translation initiation factor IF-2 OS=Blochmannia floridanus GN=infB PE=3 SV=1 550 1081 2.0E-95
sp|B0KHX8|IF2_PSEPG Translation initiation factor IF-2 OS=Pseudomonas putida (strain GB-1) GN=infB PE=3 SV=1 555 1081 2.0E-95
sp|B2TJ55|IF2_CLOBB Translation initiation factor IF-2 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=infB PE=3 SV=1 631 1083 2.0E-95
sp|B1J2A9|IF2_PSEPW Translation initiation factor IF-2 OS=Pseudomonas putida (strain W619) GN=infB PE=3 SV=1 555 1081 2.0E-95
sp|A8Z3U9|IF2_STAAT Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=infB PE=3 SV=1 561 1083 2.0E-95
sp|A6QGG8|IF2_STAAE Translation initiation factor IF-2 OS=Staphylococcus aureus (strain Newman) GN=infB PE=3 SV=1 561 1083 2.0E-95
sp|Q5HGG2|IF2_STAAC Translation initiation factor IF-2 OS=Staphylococcus aureus (strain COL) GN=infB PE=3 SV=1 561 1083 2.0E-95
sp|Q2G2D0|IF2_STAA8 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain NCTC 8325) GN=infB PE=3 SV=1 561 1083 2.0E-95
sp|Q2FHG9|IF2_STAA3 Translation initiation factor IF-2 OS=Staphylococcus aureus (strain USA300) GN=infB PE=3 SV=1 561 1083 2.0E-95
sp|C3K259|IF2_PSEFS Translation initiation factor IF-2 OS=Pseudomonas fluorescens (strain SBW25) GN=infB PE=3 SV=1 555 1081 3.0E-95
sp|Q49X54|IF2_STAS1 Translation initiation factor IF-2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=infB PE=3 SV=1 563 1083 3.0E-95
sp|Q72ER1|IF2_DESVH Translation initiation factor IF-2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=infB PE=3 SV=1 550 1083 3.0E-95
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0005525 GTP binding Yes
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup986
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1578 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4055
Ophiocordyceps camponoti-floridani Ophcf2|03207
Ophiocordyceps camponoti-rufipedis Ophun1|7198
Ophiocordyceps kimflemingae Ophio5|5701
Ophiocordyceps subramaniannii Hirsu2|8101

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1578
MLRPRVHKRRSHGFICAACRQHLFHGPGLALSSFSQLERETKAVNCRAQLFSTSFRRTKSAESGSSGTCRSQAPS
FPGSFSNVSSTSLGAFASKRLDVAPDSSQKEQLLPHELEARQQARYTVFETKGKTSTSHKKVSRDSAWTKVGLRR
VPDEVQSTKSRSVLASVFRTHHEPRPPPTPSSLPLAPRQPKSLEVGSSTNLSNELDTTAAEGSLVKQISGSPMNL
DVQQSPRPQPRATSAKRSPALAQKLGTIEGPSSRPSGYRQMAGENTVTPASPALATVILGASPPDPGRDRASPAP
TLGIFSNVKFTAGETPASALATRRENAGPSATRFGTQSSGQSLGVDSATASKPASVLGSMNFGRPEQGFGLFSSK
KVQTVVADTHASMQLSTPQSNKAKDVEPDASNEKVVTSPQVEPHSSSGKNFWEELDDRVGKLQDKDDSVSTSTQD
GKVSSLGPLDKKDRPREAQRRKSMMAEEVAAPEYGEPQYGNKKARKQFRSRSVEADGEDDEEAMGRREQQRRAKV
ERKAIKKQIAEKERAESTESEKELVESTARSILLPEYISVLHLSQALRQRCEQFIRDMEEMGFENVTSDTVMTGE
TAALIAGEYGFEPTVETGLQRDLKPRPPPLDASVLPERPPVVTIMGHVDHGKTTLLDWLRKSSIAAQEHGGITQH
IGAFIVKLSSGKTITFLDTPGHAAFLSMRQRGAKVTDIVVLVVAADDSVMPQTIEAIKHATAAQVPIIVAISKVD
KADAHIDQVKSDLARHGVQIEDYGGDVQVVCVSGRTGQGMQDLEENIIAQSEMLDLRAERDGIVEGHVLESSIKN
VGKAATILIKRGTLIPGDCIVAGQTWAKIRALRNEAGVEIDQAPPGTPVEILGWRELPAAGDEVLQAPTEAQAKI
AVEYRIEMSERQATSERIAQQEQRQREAAAAAAEAARAEAEAKLEPGAADTESDEAKAADSGPVLQNFVVKADVA
GSVEAVCSSILEMGNHEVQPRILRSSAGQISEHDIDHAAVSGSIVVNFNLAVLPHIEQRAETAKVRILNQSVIYH
VVDDIKRELSELLPPSITQRVIGEAEVLQIFSINVKRKIMRNIAGPNYF*
Coding >OphauG2|1578
ATGCTCAGGCCCCGAGTCCACAAGCGTCGCAGCCATGGCTTCATCTGCGCAGCTTGCCGACAGCATCTCTTCCAC
GGGCCAGGCTTAGCGCTATCTTCCTTTTCCCAGCTTGAAAGGGAAACAAAGGCTGTCAATTGCCGTGCTCAGCTC
TTTTCGACTTCATTCAGGCGCACCAAATCAGCTGAAAGTGGCAGCAGCGGCACTTGTCGGTCCCAAGCGCCGTCA
TTCCCCGGATCCTTTTCCAATGTCTCGTCCACTTCGTTGGGCGCCTTCGCCTCGAAGCGACTTGATGTGGCTCCA
GATTCATCACAGAAGGAACAACTTTTACCACACGAGCTCGAGGCGCGACAACAGGCGCGCTACACTGTGTTTGAG
ACCAAAGGCAAGACCTCGACTTCTCACAAGAAAGTCTCACGAGATTCTGCATGGACAAAAGTCGGCCTTAGACGC
GTTCCTGATGAGGTTCAATCCACCAAGTCGAGGTCGGTCCTGGCCAGCGTCTTCAGAACTCATCATGAGCCTCGA
CCCCCACCAACGCCTTCCTCGCTGCCACTTGCACCCAGACAGCCCAAGTCGCTCGAGGTCGGCAGCTCGACGAAT
TTATCCAACGAGCTAGACACAACTGCGGCCGAAGGCTCTCTGGTGAAGCAAATATCAGGATCCCCCATGAATCTT
GATGTACAACAATCACCAAGACCACAACCTCGAGCCACAAGCGCAAAACGTAGTCCAGCTCTAGCTCAAAAACTG
GGTACTATTGAAGGTCCTTCTTCGCGTCCCTCGGGCTATAGACAAATGGCCGGTGAGAACACAGTTACCCCAGCT
TCTCCAGCCCTGGCGACAGTCATTCTTGGAGCGTCGCCGCCCGATCCAGGCCGTGATCGAGCCAGTCCTGCCCCT
ACCCTGGGTATTTTCAGTAACGTCAAATTTACTGCTGGGGAAACACCCGCCTCAGCCTTGGCGACCAGACGCGAA
AACGCAGGCCCTAGCGCAACAAGATTTGGAACACAAAGTTCAGGCCAAAGCCTAGGCGTCGACTCGGCCACAGCT
TCGAAGCCTGCCTCAGTTCTTGGCTCCATGAACTTTGGCAGGCCAGAGCAAGGATTTGGCTTGTTTAGCAGCAAA
AAGGTGCAGACGGTGGTAGCAGACACGCACGCCTCGATGCAGTTGTCAACTCCACAGTCGAATAAAGCCAAGGAC
GTCGAACCGGATGCTTCAAATGAAAAAGTAGTCACATCCCCACAAGTGGAACCACACAGCTCAAGTGGAAAGAAT
TTTTGGGAGGAGCTTGACGACAGGGTTGGGAAATTGCAGGACAAAGATGATAGTGTTTCTACGAGCACCCAAGAT
GGTAAGGTTTCGAGCCTCGGTCCACTCGACAAAAAAGATCGGCCAAGAGAAGCTCAGCGAAGAAAGTCTATGATG
GCTGAAGAGGTGGCAGCGCCAGAGTATGGTGAACCTCAATATGGCAATAAGAAGGCCCGAAAACAGTTCAGGAGC
CGATCGGTGGAAGCAGACGGCGAAGATGATGAAGAAGCCATGGGACGCCGTGAACAACAGCGCCGTGCCAAGGTT
GAGAGGAAAGCTATTAAAAAACAAATCGCCGAGAAAGAGCGGGCTGAATCGACTGAATCCGAGAAAGAGCTGGTT
GAATCGACTGCAAGATCCATACTGCTGCCCGAGTACATCAGCGTGTTGCATTTGAGCCAAGCTCTACGTCAACGG
TGCGAACAGTTTATACGAGACATGGAAGAAATGGGGTTTGAAAATGTGACATCTGATACGGTCATGACTGGCGAA
ACTGCTGCGCTGATAGCTGGCGAATATGGCTTCGAGCCGACGGTCGAGACGGGCTTGCAAAGGGATTTGAAGCCT
CGACCGCCACCTTTAGATGCGTCTGTTTTGCCCGAACGGCCACCAGTTGTCACCATCATGGGGCATGTGGACCAT
GGAAAGACGACTCTTCTCGACTGGCTGAGAAAGTCATCAATTGCGGCACAAGAACATGGAGGCATTACGCAGCAC
ATAGGTGCTTTCATCGTCAAATTGTCTTCGGGCAAGACCATTACCTTTCTCGATACGCCTGGACACGCTGCGTTC
CTCTCGATGCGCCAACGCGGAGCCAAGGTGACTGACATTGTGGTGTTGGTGGTAGCTGCCGATGATAGTGTCATG
CCTCAAACCATCGAAGCCATAAAACACGCTACCGCGGCTCAGGTGCCCATCATTGTGGCCATTTCAAAGGTGGAT
AAGGCAGACGCGCACATCGACCAGGTCAAGTCGGACCTTGCACGCCACGGCGTACAGATTGAGGACTATGGAGGC
GATGTGCAAGTTGTGTGTGTCAGTGGCCGTACCGGCCAGGGGATGCAAGATCTCGAAGAGAATATTATTGCGCAG
TCCGAGATGCTTGATTTGCGTGCCGAGAGGGACGGTATAGTAGAGGGTCACGTTCTCGAGTCGAGCATCAAAAAC
GTTGGCAAGGCGGCAACAATACTCATCAAGCGGGGCACCCTGATTCCCGGCGACTGTATAGTTGCGGGCCAGACT
TGGGCCAAAATCAGGGCCCTACGTAATGAGGCTGGCGTTGAGATTGACCAAGCGCCCCCTGGAACACCTGTTGAG
ATATTGGGATGGAGAGAATTGCCGGCAGCAGGAGACGAGGTGCTACAGGCACCCACCGAGGCCCAAGCCAAGATT
GCGGTGGAGTATCGAATTGAGATGAGTGAGAGGCAGGCAACGTCGGAGCGCATTGCCCAACAGGAACAGCGACAA
CGCGAAGCGGCAGCGGCAGCGGCTGAGGCAGCGCGGGCAGAAGCGGAAGCAAAATTAGAGCCGGGAGCTGCCGAC
ACGGAAAGCGACGAGGCAAAAGCTGCCGATTCAGGCCCGGTGCTGCAAAATTTTGTCGTCAAAGCAGACGTGGCA
GGCTCGGTCGAGGCGGTGTGTAGCAGCATTCTTGAAATGGGCAATCATGAGGTGCAGCCGCGGATACTGCGCTCG
TCTGCTGGCCAGATTTCTGAGCACGACATTGATCACGCAGCCGTGTCGGGTAGCATTGTCGTCAACTTCAACTTG
GCAGTGCTGCCGCACATTGAACAGCGAGCAGAGACAGCAAAAGTGCGCATATTGAATCAGAGCGTCATCTATCAC
GTCGTCGATGACATAAAGCGGGAGCTGTCGGAGCTGCTGCCCCCATCAATAACGCAGCGCGTAATTGGCGAGGCT
GAAGTGTTGCAAATCTTCTCCATCAACGTCAAAAGGAAGATTATGCGCAACATTGCCGGGCCAAATTATTTTTGA
Transcript >OphauG2|1578
ATGCTCAGGCCCCGAGTCCACAAGCGTCGCAGCCATGGCTTCATCTGCGCAGCTTGCCGACAGCATCTCTTCCAC
GGGCCAGGCTTAGCGCTATCTTCCTTTTCCCAGCTTGAAAGGGAAACAAAGGCTGTCAATTGCCGTGCTCAGCTC
TTTTCGACTTCATTCAGGCGCACCAAATCAGCTGAAAGTGGCAGCAGCGGCACTTGTCGGTCCCAAGCGCCGTCA
TTCCCCGGATCCTTTTCCAATGTCTCGTCCACTTCGTTGGGCGCCTTCGCCTCGAAGCGACTTGATGTGGCTCCA
GATTCATCACAGAAGGAACAACTTTTACCACACGAGCTCGAGGCGCGACAACAGGCGCGCTACACTGTGTTTGAG
ACCAAAGGCAAGACCTCGACTTCTCACAAGAAAGTCTCACGAGATTCTGCATGGACAAAAGTCGGCCTTAGACGC
GTTCCTGATGAGGTTCAATCCACCAAGTCGAGGTCGGTCCTGGCCAGCGTCTTCAGAACTCATCATGAGCCTCGA
CCCCCACCAACGCCTTCCTCGCTGCCACTTGCACCCAGACAGCCCAAGTCGCTCGAGGTCGGCAGCTCGACGAAT
TTATCCAACGAGCTAGACACAACTGCGGCCGAAGGCTCTCTGGTGAAGCAAATATCAGGATCCCCCATGAATCTT
GATGTACAACAATCACCAAGACCACAACCTCGAGCCACAAGCGCAAAACGTAGTCCAGCTCTAGCTCAAAAACTG
GGTACTATTGAAGGTCCTTCTTCGCGTCCCTCGGGCTATAGACAAATGGCCGGTGAGAACACAGTTACCCCAGCT
TCTCCAGCCCTGGCGACAGTCATTCTTGGAGCGTCGCCGCCCGATCCAGGCCGTGATCGAGCCAGTCCTGCCCCT
ACCCTGGGTATTTTCAGTAACGTCAAATTTACTGCTGGGGAAACACCCGCCTCAGCCTTGGCGACCAGACGCGAA
AACGCAGGCCCTAGCGCAACAAGATTTGGAACACAAAGTTCAGGCCAAAGCCTAGGCGTCGACTCGGCCACAGCT
TCGAAGCCTGCCTCAGTTCTTGGCTCCATGAACTTTGGCAGGCCAGAGCAAGGATTTGGCTTGTTTAGCAGCAAA
AAGGTGCAGACGGTGGTAGCAGACACGCACGCCTCGATGCAGTTGTCAACTCCACAGTCGAATAAAGCCAAGGAC
GTCGAACCGGATGCTTCAAATGAAAAAGTAGTCACATCCCCACAAGTGGAACCACACAGCTCAAGTGGAAAGAAT
TTTTGGGAGGAGCTTGACGACAGGGTTGGGAAATTGCAGGACAAAGATGATAGTGTTTCTACGAGCACCCAAGAT
GGTAAGGTTTCGAGCCTCGGTCCACTCGACAAAAAAGATCGGCCAAGAGAAGCTCAGCGAAGAAAGTCTATGATG
GCTGAAGAGGTGGCAGCGCCAGAGTATGGTGAACCTCAATATGGCAATAAGAAGGCCCGAAAACAGTTCAGGAGC
CGATCGGTGGAAGCAGACGGCGAAGATGATGAAGAAGCCATGGGACGCCGTGAACAACAGCGCCGTGCCAAGGTT
GAGAGGAAAGCTATTAAAAAACAAATCGCCGAGAAAGAGCGGGCTGAATCGACTGAATCCGAGAAAGAGCTGGTT
GAATCGACTGCAAGATCCATACTGCTGCCCGAGTACATCAGCGTGTTGCATTTGAGCCAAGCTCTACGTCAACGG
TGCGAACAGTTTATACGAGACATGGAAGAAATGGGGTTTGAAAATGTGACATCTGATACGGTCATGACTGGCGAA
ACTGCTGCGCTGATAGCTGGCGAATATGGCTTCGAGCCGACGGTCGAGACGGGCTTGCAAAGGGATTTGAAGCCT
CGACCGCCACCTTTAGATGCGTCTGTTTTGCCCGAACGGCCACCAGTTGTCACCATCATGGGGCATGTGGACCAT
GGAAAGACGACTCTTCTCGACTGGCTGAGAAAGTCATCAATTGCGGCACAAGAACATGGAGGCATTACGCAGCAC
ATAGGTGCTTTCATCGTCAAATTGTCTTCGGGCAAGACCATTACCTTTCTCGATACGCCTGGACACGCTGCGTTC
CTCTCGATGCGCCAACGCGGAGCCAAGGTGACTGACATTGTGGTGTTGGTGGTAGCTGCCGATGATAGTGTCATG
CCTCAAACCATCGAAGCCATAAAACACGCTACCGCGGCTCAGGTGCCCATCATTGTGGCCATTTCAAAGGTGGAT
AAGGCAGACGCGCACATCGACCAGGTCAAGTCGGACCTTGCACGCCACGGCGTACAGATTGAGGACTATGGAGGC
GATGTGCAAGTTGTGTGTGTCAGTGGCCGTACCGGCCAGGGGATGCAAGATCTCGAAGAGAATATTATTGCGCAG
TCCGAGATGCTTGATTTGCGTGCCGAGAGGGACGGTATAGTAGAGGGTCACGTTCTCGAGTCGAGCATCAAAAAC
GTTGGCAAGGCGGCAACAATACTCATCAAGCGGGGCACCCTGATTCCCGGCGACTGTATAGTTGCGGGCCAGACT
TGGGCCAAAATCAGGGCCCTACGTAATGAGGCTGGCGTTGAGATTGACCAAGCGCCCCCTGGAACACCTGTTGAG
ATATTGGGATGGAGAGAATTGCCGGCAGCAGGAGACGAGGTGCTACAGGCACCCACCGAGGCCCAAGCCAAGATT
GCGGTGGAGTATCGAATTGAGATGAGTGAGAGGCAGGCAACGTCGGAGCGCATTGCCCAACAGGAACAGCGACAA
CGCGAAGCGGCAGCGGCAGCGGCTGAGGCAGCGCGGGCAGAAGCGGAAGCAAAATTAGAGCCGGGAGCTGCCGAC
ACGGAAAGCGACGAGGCAAAAGCTGCCGATTCAGGCCCGGTGCTGCAAAATTTTGTCGTCAAAGCAGACGTGGCA
GGCTCGGTCGAGGCGGTGTGTAGCAGCATTCTTGAAATGGGCAATCATGAGGTGCAGCCGCGGATACTGCGCTCG
TCTGCTGGCCAGATTTCTGAGCACGACATTGATCACGCAGCCGTGTCGGGTAGCATTGTCGTCAACTTCAACTTG
GCAGTGCTGCCGCACATTGAACAGCGAGCAGAGACAGCAAAAGTGCGCATATTGAATCAGAGCGTCATCTATCAC
GTCGTCGATGACATAAAGCGGGAGCTGTCGGAGCTGCTGCCCCCATCAATAACGCAGCGCGTAATTGGCGAGGCT
GAAGTGTTGCAAATCTTCTCCATCAACGTCAAAAGGAAGATTATGCGCAACATTGCCGGGCCAAATTATTTTTGA
Gene >OphauG2|1578
ATGCTCAGGCCCCGAGTCCACAAGGTATTATACATCTGGTCTTGTCTGCGCCCCAGCCCTGTCTGATGGCGGATA
CAGCGTCGCAGCCATGGCTTCATCTGCGCAGCTTGCCGACAGCATCTCTTCCACGGGCCAGGCTTAGCGCTATCT
TCCTTTTCCCAGCTTGAAAGGGAAACAAAGGCTGTCAATTGCCGTGCTCAGCTCTTTTCGACTTCATTCAGGCGC
ACCAAATCAGCTGAAAGTGGCAGCAGCGGCACTTGTCGGTCCCAAGCGCCGTCATTCCCCGGATCCTTTTCCAAT
GTCTCGTCCACTTCGTTGGGCGCCTTCGCCTCGAAGCGACTTGATGTGGCTCCAGATTCATCACAGAAGGAACAA
CTTTTACCACACGAGCTCGAGGCGCGACAACAGGCGCGCTACACTGTGTTTGAGACCAAAGGCAAGACCTCGACT
TCTCACAAGAAAGTCTCACGAGATTCTGCATGGACAAAAGTCGGCCTTAGACGCGTTCCTGATGAGGTTCAATCC
ACCAAGTCGAGGTCGGTCCTGGCCAGCGTCTTCAGAACTCATCATGAGCCTCGACCCCCACCAACGCCTTCCTCG
CTGCCACTTGCACCCAGACAGCCCAAGTCGCTCGAGGTCGGCAGCTCGACGAATTTATCCAACGAGCTAGACACA
ACTGCGGCCGAAGGCTCTCTGGTGAAGCAAATATCAGGATCCCCCATGAATCTTGATGTACAACAATCACCAAGA
CCACAACCTCGAGCCACAAGCGCAAAACGTAGTCCAGCTCTAGCTCAAAAACTGGGTACTATTGAAGGTCCTTCT
TCGCGTCCCTCGGGCTATAGACAAATGGCCGGTGAGAACACAGTTACCCCAGCTTCTCCAGCCCTGGCGACAGTC
ATTCTTGGAGCGTCGCCGCCCGATCCAGGCCGTGATCGAGCCAGTCCTGCCCCTACCCTGGGTATTTTCAGTAAC
GTCAAATTTACTGCTGGGGAAACACCCGCCTCAGCCTTGGCGACCAGACGCGAAAACGCAGGCCCTAGCGCAACA
AGATTTGGAACACAAAGTTCAGGCCAAAGCCTAGGCGTCGACTCGGCCACAGCTTCGAAGCCTGCCTCAGTTCTT
GGCTCCATGAACTTTGGCAGGCCAGAGCAAGGATTTGGCTTGTTTAGCAGCAAAAAGGTGCAGACGGTGGTAGCA
GACACGCACGCCTCGATGCAGTTGTCAACTCCACAGTCGAATAAAGCCAAGGACGTCGAACCGGATGCTTCAAAT
GAAAAAGTAGTCACATCCCCACAAGTGGAACCACACAGCTCAAGTGGAAAGAATTTTTGGGAGGAGCTTGACGAC
AGGGTTGGGAAATTGCAGGACAAAGATGATAGTGTTTCTACGAGCACCCAAGATGGTAAGGTTTCGAGCCTCGGT
CCACTCGACAAAAAAGATCGGCCAAGAGAAGCTCAGCGAAGAAAGTCTATGATGGCTGAAGAGGTGGCAGCGCCA
GAGTATGGTGAACCTCAATATGGCAATAAGAAGGCCCGAAAACAGTTCAGGAGCCGATCGGTGGAAGCAGACGGC
GAAGATGATGAAGAAGCCATGGGACGCCGTGAACAACAGCGCCGTGCCAAGGTTGAGAGGAAAGCTATTAAAAAA
CAAATCGCCGAGAAAGAGCGGGCTGAATCGACTGAATCCGAGAAAGAGCTGGTTGAATCGACTGCAAGATCCATA
CTGCTGCCCGAGTACATCAGCGTGTTGCATTTGAGCCAAGCTCTACGTCAACGGTGCGAACAGTTTATACGAGAC
ATGGAAGAAATGGGGTTTGAAAATGTGACATCTGATACGGTCATGACTGGCGAAACTGCTGCGCTGATAGCTGGC
GAATATGGCTTCGAGCCGACGGTCGAGACGGGCTTGCAAAGGGATTTGAAGCCTCGACCGCCACCTTTAGATGCG
TCTGTTTTGCCCGAACGGCCACCAGTTGTCACCATCATGGGGCATGTGGACCATGGAAAGACGACTCTTCTCGAC
TGGCTGAGAAAGTCATCAATTGCGGCACAAGAACATGGAGGCATTACGCAGCACATAGGTGCTTTCATCGTCAAA
TTGTCTTCGGGCAAGACCATTACCTTTCTCGATACGCCTGGACACGCTGCGTTCCTCTCGATGCGCCAACGCGGA
GCCAAGGTGACTGACATTGTGGTGTTGGTGGTAGCTGCCGATGATAGTGTCATGCCTCAAACCATCGAAGCCATA
AAACACGCTACCGCGGCTCAGGTGCCCATCATTGTGGCCATTTCAAAGGTGGATAAGGCAGACGCGCACATCGAC
CAGGTCAAGTCGGACCTTGCACGCCACGGCGTACAGATTGAGGACTATGGAGGCGATGTGCAAGTTGTGTGTGTC
AGTGGCCGTACCGGCCAGGGGATGCAAGATCTCGAAGAGAATATTATTGCGCAGTCCGAGATGCTTGATTTGCGT
GCCGAGAGGGACGGTATAGTAGAGGGTCACGTTCTCGAGTCGAGCATCAAAAACGTTGGCAAGGCGGCAACAATA
CTCATCAAGCGGGGCACCCTGATTCCCGGCGACTGTATAGTTGCGGGCCAGACTTGGGCCAAAATCAGGGCCCTA
CGTAATGAGGCTGGCGTTGAGATTGACCAAGCGCCCCCTGGAACACCTGTTGAGATATTGGGATGGAGAGAATTG
CCGGCAGCAGGAGACGAGGTGCTACAGGCACCCACCGAGGCCCAAGCCAAGATTGCGGTGGAGTATCGAATTGAG
ATGAGTGAGAGGCAGGCAACGTCGGAGCGCATTGCCCAACAGGAACAGCGACAACGCGAAGCGGCAGCGGCAGCG
GCTGAGGCAGCGCGGGCAGAAGCGGAAGCAAAATTAGAGCCGGGAGCTGCCGACACGGAAAGCGACGAGGCAAAA
GCTGCCGATTCAGGCCCGGTGCTGCAAAATTTTGTCGTCAAAGCAGACGTGGCAGGCTCGGTCGAGGCGGTGTGT
AGCAGCATTCTTGAAATGGGCAATCATGAGGTGCAGCCGCGGATACTGCGCTCGTCTGCTGGCCAGATTTCTGAG
CACGACATTGATCACGCAGCCGTGTCGGGTAGCATTGTCGTCAACTTCAACTTGGCAGTGCTGCCGCACATTGAA
CAGCGAGCAGAGACAGCAAAAGTGCGCATATTGAATCAGAGCGTCATCTATCACGTCGTCGATGACATAAAGCGG
GAGCTGTCGGAGCTGCTGCCCCCATCAATAACGCAGCGCGTAATTGGCGAGGCTGAAGTGTTGCAAATCTTCTCC
ATCAACGTCAAAAGGAAGATTATGCGCAACATTGCCGGTGTAAGGGTGCGCAATGGGACCATCAAGAAGGCGTCT
CGTGTACGAGTGTTGCGCCAGGGCCAAATTATTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail