Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1575
Gene name
LocationContig_1485:2472..3516
Strand-
Gene length (bp)1044
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16483 Glyco_hydro_64 Beta-1,3-glucanase 5.3E-126 2 342

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22222|E13B_CELCE Glucan endo-1,3-beta-glucosidase OS=Cellulosimicrobium cellulans PE=1 SV=1 25 338 9.0E-31
sp|Q59146|E13B_ARTSW Glucan endo-1,3-beta-glucosidase OS=Arthrobacter sp. (strain YCWD3) GN=glcI PE=3 SV=1 25 338 5.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1575
MSSDGKTIYRPASPATPLKPLATADCAMALGPSGSSRTIHVPRMFGARIWFCKNQPLHFFVNPGPALVEPSATNT
ADLNYGLDWGFCEFTWNAEQIYVNVSFVDFFSLPVSLRLDTVDGVVKTVPGMPSDGLSSVCAKLEDQARREGKPW
NRLVIRSSADGKPLRALSPNAGGALFPGLFDGYYKSYVDAVWKKYQSQDLTVQTQFKWGDVKGRVDARSGRLVFN
SHDVGEFNKPSAQDIFTCSTGPFAADPKISDERLNVGARLAAALNRSTLDVNSQQPEGEDVDTYYRNPITNHYAR
ICHETSLEGRGYAFPYDDVGASESVDQSGFVNAPNPKMLTVGIGKPL*
Coding >OphauG2|1575
ATGTCGTCGGACGGCAAAACGATATATCGGCCCGCGTCTCCTGCTACACCCCTTAAGCCATTGGCCACTGCCGAC
TGCGCAATGGCTCTTGGGCCCTCGGGCAGTTCGCGCACCATACATGTACCGCGCATGTTTGGCGCCCGCATCTGG
TTCTGTAAAAACCAGCCGCTGCATTTCTTTGTCAATCCGGGTCCCGCCCTTGTCGAGCCCTCGGCCACGAATACA
GCCGATCTGAATTATGGCCTGGACTGGGGCTTTTGCGAGTTTACATGGAACGCGGAACAAATCTACGTCAACGTT
TCTTTTGTCGACTTTTTCAGCCTGCCTGTCTCGCTGCGTCTTGATACCGTCGACGGCGTCGTCAAGACTGTCCCC
GGCATGCCGTCTGATGGCTTGTCAAGTGTCTGCGCAAAGCTTGAGGATCAGGCTCGTCGCGAGGGCAAACCGTGG
AACCGTCTTGTTATCCGCAGCTCGGCCGACGGCAAACCACTACGAGCCCTCAGTCCTAATGCTGGCGGAGCTCTC
TTCCCAGGCCTCTTTGATGGATACTACAAGTCGTACGTCGACGCAGTGTGGAAAAAGTACCAGTCCCAGGACCTG
ACGGTCCAGACCCAGTTCAAATGGGGAGACGTCAAAGGCCGCGTTGACGCTCGGTCTGGCCGTCTCGTCTTCAAC
AGCCACGATGTTGGTGAATTTAACAAGCCCTCGGCTCAAGATATATTCACTTGCAGCACAGGGCCCTTTGCCGCC
GACCCCAAGATCTCTGACGAACGACTCAATGTCGGTGCCCGTCTGGCCGCCGCTTTGAATCGCTCTACTCTAGAC
GTCAACTCGCAACAGCCCGAGGGTGAGGATGTCGACACATACTATCGCAATCCCATCACCAACCACTACGCCCGC
ATCTGTCATGAGACGAGTCTCGAGGGTCGCGGCTACGCCTTTCCATATGACGATGTCGGTGCCTCAGAGTCGGTT
GACCAGTCAGGCTTTGTCAATGCTCCCAATCCAAAGATGCTTACCGTTGGCATCGGCAAACCTCTCTAG
Transcript >OphauG2|1575
ATGTCGTCGGACGGCAAAACGATATATCGGCCCGCGTCTCCTGCTACACCCCTTAAGCCATTGGCCACTGCCGAC
TGCGCAATGGCTCTTGGGCCCTCGGGCAGTTCGCGCACCATACATGTACCGCGCATGTTTGGCGCCCGCATCTGG
TTCTGTAAAAACCAGCCGCTGCATTTCTTTGTCAATCCGGGTCCCGCCCTTGTCGAGCCCTCGGCCACGAATACA
GCCGATCTGAATTATGGCCTGGACTGGGGCTTTTGCGAGTTTACATGGAACGCGGAACAAATCTACGTCAACGTT
TCTTTTGTCGACTTTTTCAGCCTGCCTGTCTCGCTGCGTCTTGATACCGTCGACGGCGTCGTCAAGACTGTCCCC
GGCATGCCGTCTGATGGCTTGTCAAGTGTCTGCGCAAAGCTTGAGGATCAGGCTCGTCGCGAGGGCAAACCGTGG
AACCGTCTTGTTATCCGCAGCTCGGCCGACGGCAAACCACTACGAGCCCTCAGTCCTAATGCTGGCGGAGCTCTC
TTCCCAGGCCTCTTTGATGGATACTACAAGTCGTACGTCGACGCAGTGTGGAAAAAGTACCAGTCCCAGGACCTG
ACGGTCCAGACCCAGTTCAAATGGGGAGACGTCAAAGGCCGCGTTGACGCTCGGTCTGGCCGTCTCGTCTTCAAC
AGCCACGATGTTGGTGAATTTAACAAGCCCTCGGCTCAAGATATATTCACTTGCAGCACAGGGCCCTTTGCCGCC
GACCCCAAGATCTCTGACGAACGACTCAATGTCGGTGCCCGTCTGGCCGCCGCTTTGAATCGCTCTACTCTAGAC
GTCAACTCGCAACAGCCCGAGGGTGAGGATGTCGACACATACTATCGCAATCCCATCACCAACCACTACGCCCGC
ATCTGTCATGAGACGAGTCTCGAGGGTCGCGGCTACGCCTTTCCATATGACGATGTCGGTGCCTCAGAGTCGGTT
GACCAGTCAGGCTTTGTCAATGCTCCCAATCCAAAGATGCTTACCGTTGGCATCGGCAAACCTCTCTAG
Gene >OphauG2|1575
ATGTCGTCGGACGGCAAAACGATATATCGGCCCGCGTCTCCTGCTACACCCCTTAAGCCATTGGCCACTGCCGAC
TGCGCAATGGCTCTTGGGCCCTCGGGCAGTTCGCGCACCATACATGTACCGCGCATGTTTGGCGCCCGCATCTGG
TTCTGTAAAAACCAGCCGCTGCATTTCTTTGTCAATCCGGGTCCCGCCCTTGTCGAGCCCTCGGCCACGAATACA
GCCGATCTGAATTATGGCCTGGACTGGGGCTTTTGCGAGTTTACATGGAACGCGGAACAAATCTACGTCAACGTT
TCTTTTGTCGACTTTTTCAGCCTGCCTGTCTCGCTGCGTCTTGATACCGTCGACGGCGTCGTCAAGACTGTCCCC
GGCATGCCGTCTGATGGCTTGTCAAGTGTCTGCGCAAAGCTTGAGGATCAGGCTCGTCGCGAGGGCAAACCGTGG
AACCGTCTTGTTATCCGCAGCTCGGCCGACGGCAAACCACTACGAGCCCTCAGTCCTAATGCTGGCGGAGCTCTC
TTCCCAGGCCTCTTTGATGGATACTACAAGTCGTACGTCGACGCAGTGTGGAAAAAGTACCAGTCCCAGGACCTG
ACGGTCCAGACCCAGTTCAAATGGGGAGACGTCAAAGGCCGCGTTGACGCTCGGTCTGGCCGTCTCGTCTTCAAC
AGCCACGATGTTGGTGAATTTAACAAGCCCTCGGCTCAAGATATATTCACTTGCAGCACAGGGCCCTTTGCCGCC
GACCCCAAGATCTCTGACGAACGACTCAATGTCGGTGCCCGTCTGGCCGCCGCTTTGAATCGCTCTACTCTAGAC
GTCAACTCGCAACAGCCCGAGGGTGAGGATGTCGACACATACTATCGCAATCCCATCACCAACCACTACGCCCGC
ATCTGTCATGAGACGAGTCTCGAGGGTCGCGGCTACGCCTTTCCATATGACGATGTCGGTGCCTCAGAGTCGGTT
GACCAGTCAGGCTTTGTCAATGCTCCCAATCCAAAGATGCTTACCGTTGGCATCGGCAAACCTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail