Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1568
Gene name
LocationContig_1481:85..751
Strand-
Gene length (bp)666
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup117
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1568 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5034
Ophiocordyceps australis map64 (Brazil) OphauB2|4034
Ophiocordyceps camponoti-floridani Ophcf2|00717
Ophiocordyceps camponoti-floridani Ophcf2|06855
Ophiocordyceps camponoti-rufipedis Ophun1|2681
Ophiocordyceps camponoti-rufipedis Ophun1|3369
Ophiocordyceps kimflemingae Ophio5|1993
Ophiocordyceps kimflemingae Ophio5|2077
Ophiocordyceps kimflemingae Ophio5|6199
Ophiocordyceps kimflemingae Ophio5|7935
Ophiocordyceps subramaniannii Hirsu2|3551
Ophiocordyceps subramaniannii Hirsu2|3569
Ophiocordyceps subramaniannii Hirsu2|7031

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1568
MLWNQLARSLDDGIKPLNLDGSRGVLFKVTLLAYGYTFVSKATVRAFVDELNHEATVYKRLKKLQGIIVPVFLGS
IDLSSMKKIYYYAHRVYLVHMTFLSWGGTDIARTEKTPNMDYASLETKSIQSLEALHQEGVIHTDARLPNMLVNS
ETNGVMIIDFERSILLEPPRRPLAQLIPRKREWKPDIQGDKEMDGQSRKQKVARRFATEIGEAKCEFLPFK*
Coding >OphauG2|1568
ATGCTCTGGAATCAGCTAGCACGATCTCTTGACGATGGAATCAAACCGTTAAATCTGGATGGCTCGCGAGGCGTG
CTTTTCAAGGTGACTTTACTTGCGTATGGCTATACCTTTGTTAGCAAAGCCACAGTTCGAGCTTTCGTCGACGAA
CTCAACCACGAAGCTACAGTTTACAAACGGCTTAAAAAGCTTCAAGGCATAATCGTGCCTGTCTTCTTAGGGTCC
ATTGACCTGTCCTCTATGAAGAAGATATACTACTACGCGCATCGGGTCTACTTGGTGCACATGACTTTCTTGTCA
TGGGGAGGGACTGACATTGCCCGGACGGAAAAGACGCCTAATATGGATTATGCGTCGCTTGAAACAAAGAGCATT
CAATCTTTGGAGGCCCTGCATCAGGAAGGTGTAATTCACACAGACGCGCGCCTTCCAAACATGTTGGTCAACTCT
GAGACTAATGGAGTCATGATTATTGACTTTGAACGCTCCATCTTGCTCGAGCCGCCTCGGCGTCCATTGGCGCAA
TTAATACCGCGCAAGAGAGAATGGAAGCCTGATATACAAGGTGATAAAGAGATGGATGGTCAATCACGCAAGCAG
AAGGTAGCACGTCGATTTGCCACTGAAATCGGCGAGGCGAAATGCGAGTTTCTGCCTTTTAAATAA
Transcript >OphauG2|1568
ATGCTCTGGAATCAGCTAGCACGATCTCTTGACGATGGAATCAAACCGTTAAATCTGGATGGCTCGCGAGGCGTG
CTTTTCAAGGTGACTTTACTTGCGTATGGCTATACCTTTGTTAGCAAAGCCACAGTTCGAGCTTTCGTCGACGAA
CTCAACCACGAAGCTACAGTTTACAAACGGCTTAAAAAGCTTCAAGGCATAATCGTGCCTGTCTTCTTAGGGTCC
ATTGACCTGTCCTCTATGAAGAAGATATACTACTACGCGCATCGGGTCTACTTGGTGCACATGACTTTCTTGTCA
TGGGGAGGGACTGACATTGCCCGGACGGAAAAGACGCCTAATATGGATTATGCGTCGCTTGAAACAAAGAGCATT
CAATCTTTGGAGGCCCTGCATCAGGAAGGTGTAATTCACACAGACGCGCGCCTTCCAAACATGTTGGTCAACTCT
GAGACTAATGGAGTCATGATTATTGACTTTGAACGCTCCATCTTGCTCGAGCCGCCTCGGCGTCCATTGGCGCAA
TTAATACCGCGCAAGAGAGAATGGAAGCCTGATATACAAGGTGATAAAGAGATGGATGGTCAATCACGCAAGCAG
AAGGTAGCACGTCGATTTGCCACTGAAATCGGCGAGGCGAAATGCGAGTTTCTGCCTTTTAAATAA
Gene >OphauG2|1568
ATGCTCTGGAATCAGCTAGCACGATCTCTTGACGATGGAATCAAACCGTTAAATCTGGATGGCTCGCGAGGCGTG
CTTTTCAAGGTGACTTTACTTGCGTATGGCTATACCTTTGTTAGCAAAGCCACAGTTCGAGCTTTCGTCGACGAA
CTCAACCACGAAGCTACAGTTTACAAACGGCTTAAAAAGCTTCAAGGCATAATCGTGCCTGTCTTCTTAGGGTCC
ATTGACCTGTCCTCTATGAAGAAGATATACTACTACGCGCATCGGGTCTACTTGGTGCACATGACTTTCTTGTCA
TGGGGAGGGACTGACATTGCCCGGACGGAAAAGACGCCTAATATGGATTATGCGTCGCTTGAAACAAAGAGCATT
CAATCTTTGGAGGCCCTGCATCAGGAAGGTGTAATTCACACAGACGCGCGCCTTCCAAACATGTTGGTCAACTCT
GAGACTAATGGAGTCATGATTATTGACTTTGAACGCTCCATCTTGCTCGAGCCGCCTCGGCGTCCATTGGCGCAA
TTAATACCGCGCAAGAGAGAATGGAAGCCTGATATACAAGGTGATAAAGAGATGGATGGTCAATCACGCAAGCAG
AAGGTAGCACGTCGATTTGCCACTGAAATCGGCGAGGCGAAATGCGAGTTTCTGCCTTTTAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail