Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1567
Gene name
LocationContig_1480:1248..2987
Strand-
Gene length (bp)1739
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1567 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1332
Ophiocordyceps camponoti-floridani Ophcf2|00459
Ophiocordyceps camponoti-rufipedis Ophun1|1090
Ophiocordyceps kimflemingae Ophio5|1910
Ophiocordyceps subramaniannii Hirsu2|2313
Ophiocordyceps subramaniannii Hirsu2|2314

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1567
MSPKLKPLLLPQIVERRRQVDALSTDNGDVSQVYFTTNSSCSDVTSPLTPTFSAPAHQRLSSSSSSLELPPQAYD
TPSSPPQLLAVKPDKTPLPDVEEERYDDDDDAASEYFGLYSCLCDNVCPHRNSADHCFFPESVPDDSEIDYDMGF
LSDGDLSADLRLPKKRAMVDSSPFAALTSRLGSRLPTMKRWRSHKRNGSKPTPLSDANFANDMSREPSSRSSSIS
GSNHHMTESRVNAFATAPSSISCLSSDDNLCMSPLVSMTPEEHSNLEVERSMATTPLLPPLLTDPLQKPPPESPI
ESPLQSPTVAPPSAATLISGPSSITPRSSRPPLSSRPSLTSLRQMSSGTDLPLSLPSIMQDHDEWSDRLGHANFT
ITPVPYQPDSITTETVQKFLSHRNLASSNYAKHLLRVKEHYGHTSMIYAMTEMKWEETQAKWKSIYQAIFTQNSR
SAPASTNHSRNHSRGRGRGRSNSSVAAVDHLDSNHDYLADVEWRRIDDCHPGAVPRMLESLNVHGKFPCRGEEDI
VGLMERETVMIRARSEDAKGRFWRSIVDKVGLRK*
Coding >OphauG2|1567
ATGTCGCCCAAGCTCAAGCCCTTGCTGCTGCCGCAGATTGTCGAGCGCCGTAGACAGGTAGACGCCCTATCAACC
GACAATGGCGACGTCTCACAAGTCTACTTCACCACAAACTCGTCTTGCTCAGACGTCACCTCTCCACTCACGCCC
ACTTTTTCCGCCCCAGCACACCAGCGCTTGTCCAGCTCGTCCTCTTCTCTCGAACTGCCCCCCCAGGCCTACGAC
ACTCCTTCCTCTCCCCCTCAGCTCCTCGCTGTCAAGCCCGACAAGACCCCGCTACCCGATGTCGAGGAAGAGCGC
TACGATGACGACGACGACGCTGCCTCGGAGTACTTTGGCCTATACAGCTGTTTGTGCGACAACGTCTGTCCTCAT
CGCAACAGCGCAGACCACTGCTTCTTCCCCGAATCTGTACCTGACGACTCGGAAATTGACTACGACATGGGTTTC
CTCAGCGATGGCGACTTGTCTGCCGACTTGCGCCTCCCCAAGAAGAGGGCCATGGTCGACTCCTCGCCCTTTGCC
GCATTGACTTCACGCCTTGGCTCGCGACTGCCAACCATGAAGCGATGGAGGTCCCACAAGCGCAATGGCTCCAAG
CCCACCCCCCTCAGTGACGCCAATTTTGCCAACGACATGTCTCGTGAGCCATCAAGTCGTTCCTCATCCATTTCC
GGTTCCAATCACCACATGACTGAGAGCAGAGTCAACGCTTTTGCCACGGCTCCCAGCTCAATTTCATGCTTGAGC
AGTGATGACAACTTGTGCATGTCGCCACTCGTGTCCATGACGCCCGAGGAGCACTCCAACCTCGAGGTTGAACGG
TCCATGGCTACCACCCCTCTGCTGCCCCCACTTCTCACCGATCCTCTGCAAAAGCCACCGCCAGAGTCCCCCATC
GAATCACCGCTCCAGTCGCCCACTGTGGCGCCGCCATCGGCCGCGACTTTGATCTCGGGCCCCTCTAGCATAACG
CCGCGTTCATCCCGCCCACCATTGAGCTCTCGCCCCTCTCTTACTTCTCTGCGGCAGATGTCTTCTGGTACCGAT
CTGCCACTTTCACTACCGAGCATAATGCAAGATCACGATGAGTGGTCGGACCGCCTTGGCCATGCAAACTTTACC
ATCACCCCCGTACCCTATCAACCCGACTCCATCACAACCGAGACGGTTCAAAAATTTCTCAGTCATCGTAATCTA
GCCTCATCAAATTATGCCAAGCACCTTTTACGCGTCAAGGAGCACTACGGCCACACGAGCATGATTTATGCCATG
ACGGAGATGAAGTGGGAAGAGACACAAGCAAAGTGGAAGAGCATCTACCAGGCTATTTTCACTCAAAATAGTCGC
TCCGCACCAGCCTCGACCAACCACTCACGCAACCACAGTCGAGGCAGGGGACGTGGCCGCTCCAACAGCTCTGTG
GCTGCCGTGGACCACCTGGATTCCAATCATGACTACCTTGCCGACGTGGAATGGAGGCGCATCGATGATTGTCAT
CCTGGCGCTGTCCCACGCATGCTTGAGTCACTCAACGTGCACGGCAAGTTTCCATGTCGGGGTGAGGAAGATATC
GTTGGCCTCATGGAGCGTGAAACCGTCATGATTCGAGCGCGAAGTGAGGATGCCAAGGGCCGATTCTGGAGAAGT
ATTGTTGACAAGGTTGGCCTCCGCAAATGA
Transcript >OphauG2|1567
ATGTCGCCCAAGCTCAAGCCCTTGCTGCTGCCGCAGATTGTCGAGCGCCGTAGACAGGTAGACGCCCTATCAACC
GACAATGGCGACGTCTCACAAGTCTACTTCACCACAAACTCGTCTTGCTCAGACGTCACCTCTCCACTCACGCCC
ACTTTTTCCGCCCCAGCACACCAGCGCTTGTCCAGCTCGTCCTCTTCTCTCGAACTGCCCCCCCAGGCCTACGAC
ACTCCTTCCTCTCCCCCTCAGCTCCTCGCTGTCAAGCCCGACAAGACCCCGCTACCCGATGTCGAGGAAGAGCGC
TACGATGACGACGACGACGCTGCCTCGGAGTACTTTGGCCTATACAGCTGTTTGTGCGACAACGTCTGTCCTCAT
CGCAACAGCGCAGACCACTGCTTCTTCCCCGAATCTGTACCTGACGACTCGGAAATTGACTACGACATGGGTTTC
CTCAGCGATGGCGACTTGTCTGCCGACTTGCGCCTCCCCAAGAAGAGGGCCATGGTCGACTCCTCGCCCTTTGCC
GCATTGACTTCACGCCTTGGCTCGCGACTGCCAACCATGAAGCGATGGAGGTCCCACAAGCGCAATGGCTCCAAG
CCCACCCCCCTCAGTGACGCCAATTTTGCCAACGACATGTCTCGTGAGCCATCAAGTCGTTCCTCATCCATTTCC
GGTTCCAATCACCACATGACTGAGAGCAGAGTCAACGCTTTTGCCACGGCTCCCAGCTCAATTTCATGCTTGAGC
AGTGATGACAACTTGTGCATGTCGCCACTCGTGTCCATGACGCCCGAGGAGCACTCCAACCTCGAGGTTGAACGG
TCCATGGCTACCACCCCTCTGCTGCCCCCACTTCTCACCGATCCTCTGCAAAAGCCACCGCCAGAGTCCCCCATC
GAATCACCGCTCCAGTCGCCCACTGTGGCGCCGCCATCGGCCGCGACTTTGATCTCGGGCCCCTCTAGCATAACG
CCGCGTTCATCCCGCCCACCATTGAGCTCTCGCCCCTCTCTTACTTCTCTGCGGCAGATGTCTTCTGGTACCGAT
CTGCCACTTTCACTACCGAGCATAATGCAAGATCACGATGAGTGGTCGGACCGCCTTGGCCATGCAAACTTTACC
ATCACCCCCGTACCCTATCAACCCGACTCCATCACAACCGAGACGGTTCAAAAATTTCTCAGTCATCGTAATCTA
GCCTCATCAAATTATGCCAAGCACCTTTTACGCGTCAAGGAGCACTACGGCCACACGAGCATGATTTATGCCATG
ACGGAGATGAAGTGGGAAGAGACACAAGCAAAGTGGAAGAGCATCTACCAGGCTATTTTCACTCAAAATAGTCGC
TCCGCACCAGCCTCGACCAACCACTCACGCAACCACAGTCGAGGCAGGGGACGTGGCCGCTCCAACAGCTCTGTG
GCTGCCGTGGACCACCTGGATTCCAATCATGACTACCTTGCCGACGTGGAATGGAGGCGCATCGATGATTGTCAT
CCTGGCGCTGTCCCACGCATGCTTGAGTCACTCAACGTGCACGGCAAGTTTCCATGTCGGGGTGAGGAAGATATC
GTTGGCCTCATGGAGCGTGAAACCGTCATGATTCGAGCGCGAAGTGAGGATGCCAAGGGCCGATTCTGGAGAAGT
ATTGTTGACAAGGTTGGCCTCCGCAAATGA
Gene >OphauG2|1567
ATGTCGCCCAAGCTCAAGCCCTTGCTGCTGCCGCAGATTGTCGAGCGCCGTAGACAGGTAGACGCCCTATCAACC
GACAATGGCGACGTCTCACAAGTCTACTTCACCACAAACTCGTCTTGCTCAGACGTCACCTCTCCACTCACGCCC
ACTTTTTCCGCCCCAGCACACCAGCGCTTGTCCAGCTCGTCCTCTTCTCTCGAACTGCCCCCCCAGGCCTACGAC
ACTCCTTCCTCTCCCCCTCAGCTCCTCGCTGTCAAGCCCGACAAGACCCCGCTACCCGATGTCGAGGAAGAGCGC
TACGATGACGACGACGACGCTGCCTCGGAGTACTTTGGCCTATACAGCTGTTTGTGTGAGTATTGGTCCTCGTGT
GCTCCACGCCAAGCTTCCATGGCTGATGGCCTCTTCAAGGCGACAACGTCTGTCCTCATCGCAACAGCGCAGACC
ACTGCTTCTTCCCCGAATCTGTACCTGACGACTCGGAAATTGACTACGACATGGGTTTCCTCAGCGATGGCGACT
TGTCTGCCGACTTGCGCCTCCCCAAGAAGAGGGCCATGGTCGACTCCTCGCCCTTTGCCGCATTGACTTCACGCC
TTGGCTCGCGACTGCCAACCATGAAGCGATGGAGGTCCCACAAGCGCAATGGCTCCAAGCCCACCCCCCTCAGTG
ACGCCAATTTTGCCAACGACATGTCTCGTGAGCCATCAAGTCGTTCCTCATCCATTTCCGGTTCCAATCACCACA
TGACTGAGAGCAGAGTCAACGCTTTTGCCACGGCTCCCAGCTCAATTTCATGCTTGAGCAGTGATGACAACTTGT
GCATGTCGCCACTCGTGTCCATGACGCCCGAGGAGCACTCCAACCTCGAGGTTGAACGGTCCATGGCTACCACCC
CTCTGCTGCCCCCACTTCTCACCGATCCTCTGCAAAAGCCACCGCCAGAGTCCCCCATCGAATCACCGCTCCAGT
CGCCCACTGTGGCGCCGCCATCGGCCGCGACTTTGATCTCGGGCCCCTCTAGCATAACGCCGCGTTCATCCCGCC
CACCATTGAGCTCTCGCCCCTCTCTTACTTCTCTGCGGCAGATGTCTTCTGGTACCGATCTGCCACTTTCACTAC
CGAGCATAATGCAAGATCACGATGAGTGGTCGGACCGCCTTGGCCATGCAAACTTTACCATCACCCCCGTACCCT
ATCAACCCGACTCCATCACAACCGAGACGGTTCAAAAATTTCTCAGTCATCGTAATCTAGCCTCATCAAATTATG
CCAAGCACCTTTTACGCGTCAAGGAGCACTACGGCCACACGAGCATGATTTATGCCATGACGGAGATGAAGTGGG
AAGAGACACAAGCAAAGTGGAAGAGCATCTACCAGGCTATTTTCACTCAAAATAGTCGCTCCGCACCAGCCTCGA
CCAACCACTCACGCAACCACAGTCGAGGCAGGGGACGTGGCCGCTCCAACAGCTCTGTGGCTGCCGTGGACCACC
TGGATTCCAATCATGACTACCTTGCCGACGTGGAATGGAGGCGCATCGATGATTGTCATCCTGGCGCTGTCCCAC
GCATGCTTGAGTCACTCAACGTGCACGGCAAGTTTCCATGTCGGGGTGAGGAAGATATCGTTGGCCTCATGGAGC
GTGAAACCGTCATGATTCGAGCGCGAAGTGAGGATGCCAAGGGCCGATTCTGGAGAAGTATTGTTGACAAGGTTG
GCCTCCGCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail