Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1566
Gene name
LocationContig_148:25822..26545
Strand-
Gene length (bp)723
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2418
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1566 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4788
Ophiocordyceps camponoti-floridani Ophcf2|03410
Ophiocordyceps camponoti-rufipedis Ophun1|1275
Ophiocordyceps kimflemingae Ophio5|3881
Ophiocordyceps subramaniannii Hirsu2|3433

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1566
MAPSARTSVRYSAFSMAAPSLTPTLQTSDSGQAEIRDIALGLDRMENKALSSQRVALSDEKSDSLSKLALGAKLE
RALDRRMSSQDAVMRPRQASLSVNEKKQLSKST*
Coding >OphauG2|1566
ATGGCTCCCTCGGCCAGAACCTCTGTTCGCTATAGCGCCTTCAGCATGGCTGCCCCCTCGTTAACACCCACATTG
CAAACATCCGACTCTGGCCAAGCCGAAATCCGCGACATTGCCCTCGGCCTCGACCGCATGGAGAACAAGGCGCTC
TCTTCGCAGCGCGTAGCCCTCAGCGACGAGAAATCGGATAGCTTGAGCAAGCTCGCCCTGGGCGCCAAACTTGAG
CGTGCTCTCGATCGCCGCATGAGCAGCCAAGACGCCGTCATGCGCCCCAGACAAGCCAGTCTCTCCGTCAATGAA
AAGAAGCAACTCTCCAAGTCGACGTAA
Transcript >OphauG2|1566
ATGGCTCCCTCGGCCAGAACCTCTGTTCGCTATAGCGCCTTCAGCATGGCTGCCCCCTCGTTAACACCCACATTG
CAAACATCCGACTCTGGCCAAGCCGAAATCCGCGACATTGCCCTCGGCCTCGACCGCATGGAGAACAAGGCGCTC
TCTTCGCAGCGCGTAGCCCTCAGCGACGAGAAATCGGATAGCTTGAGCAAGCTCGCCCTGGGCGCCAAACTTGAG
CGTGCTCTCGATCGCCGCATGAGCAGCCAAGACGCCGTCATGCGCCCCAGACAAGCCAGTCTCTCCGTCAATGAA
AAGAAGCAACTCTCCAAGTCGACGTAA
Gene >OphauG2|1566
ATGGCTCCCTCGGTTTGTCTGCCCTCCCCCTTTTGAATGGTTGCATCATGTGAAATAATATCATGAGACTGCTCA
ATTTCATGCCCGTGTCCCGCCCTTGCCCGTGTTCCCATGATTTGCTTGCGCGCGCCGAGGGGGGTTTTTTTTTTT
GCTTTCGCAAGACATTCAACTTCCAATTTCCAATTTCCGCACGGCCGCCACTTGTCTGTTTTTAAACTCAATTTC
TTCCTGTCAAACCCTTAGCCTTTTTTCTCTTTATTGACTCGCCTTGCTTGTTCGAGGGACCATCAAGAAAGAAAG
AAAAAAACTCATCCCCCTCTTGTTTCTATGCCCCCGGCTCTACTTCTTTCCCATCTTTCTATATTTTCCAGCTTG
TCCAGCTAATCATTCATCATGCTCTACAAACAGGCCAGAACCTCTGTTCGCTATAGCGCCTTCAGCATGGCTGCC
CCCTCGTTAACACCCACATTGCAAACATCCGACTCTGGCCAAGCCGAAATCCGCGACATTGCCCTCGGCCTCGAC
CGCATGGAGAACAAGGCGCTCTCTTCGCAGCGCGTAGCCCTCAGCGACGAGAAATCGGATAGCTTGAGCAAGCTC
GCCCTGGGCGCCAAACTTGAGCGTGCTCTCGATCGCCGCATGAGCAGCCAAGACGCCGTCATGCGCCCCAGACAA
GCCAGTCTCTCCGTCAATGAAAAGAAGCAACTCTCCAAGTCGACGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail