Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1559
Gene name
LocationContig_148:10975..13343
Strand-
Gene length (bp)2368
Transcript length (bp)2265
Coding sequence length (bp)2265
Protein length (aa) 755

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02065 Melibiase Melibiase 4.4E-149 307 658
PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain 2.7E-77 59 302
PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain 3.0E-20 671 746

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 1 748 0.0E+00
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 33 748 0.0E+00
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 33 748 0.0E+00
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 30 748 0.0E+00
sp|Q5AU92|AGALC_EMENI Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglC PE=1 SV=1 33 748 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92457|AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina GN=agl2 PE=1 SV=1 1 748 0.0E+00
sp|B8NWY6|AGALC_ASPFN Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=aglC PE=3 SV=2 33 748 0.0E+00
sp|Q2TW69|AGALC_ASPOR Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aglC PE=3 SV=1 33 748 0.0E+00
sp|Q9UUZ4|AGALC_ASPNG Alpha-galactosidase C OS=Aspergillus niger GN=aglC PE=1 SV=1 30 748 0.0E+00
sp|Q5AU92|AGALC_EMENI Alpha-galactosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglC PE=1 SV=1 33 748 0.0E+00
sp|Q0CVH2|AGALC_ASPTN Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglC PE=3 SV=1 15 749 0.0E+00
sp|Q0CEF5|AGALG_ASPTN Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=aglG PE=3 SV=1 29 748 0.0E+00
sp|Q5ARP5|AGALG_EMENI Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aglG PE=2 SV=1 31 748 0.0E+00
sp|P43467|AGAL1_PEDPE Alpha-galactosidase 1 OS=Pediococcus pentosaceus GN=agaR PE=3 SV=1 33 730 2.0E-156
sp|P27756|AGAL_STRMU Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=aga PE=3 SV=3 92 748 8.0E-136
sp|P43469|AGAL2_PEDPE Alpha-galactosidase 2 OS=Pediococcus pentosaceus GN=agaS PE=3 SV=1 79 748 6.0E-115
sp|P16551|RAFA_ECOLX Alpha-galactosidase OS=Escherichia coli GN=rafA PE=1 SV=1 100 715 5.0E-79
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999767

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH36 5.9E-239 40 731

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2424
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1559 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4795
Ophiocordyceps camponoti-floridani Ophcf2|00511
Ophiocordyceps camponoti-rufipedis Ophun1|6740
Ophiocordyceps kimflemingae Ophio5|1234
Ophiocordyceps subramaniannii Hirsu2|3439

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1559
MASPSLCQLAVVLVVLGLTGVWCNDRQDLAEPIVVDGSSFALNGARVSYRFHVDNTSGDLISDHFGASVDGDSIE
AELDPIHGWVGMIGRVRREFPDQDRGDFRTPAVRIRQTQGYTVSSFRYQSHQVTTGKPSLQGLPSTFGTDDQAST
LTIHLWDEYSSVAADLSYSVFPEYDAIVRSTAVTNKGNSTITIEKLHSLSVDLPHGDYDMLQLRGDWAREGVRVR
RKVDFGSQGFCSSAGYSSHFHNPFLSLLSPLTTETHGEAWGFSLIYTGSFCVEVEKGSQDLTRAMMGLNPHQLSW
VLGPGESFVSPEAVAVFSDEGIGAMSRKLHRLYRHNLMKSKFALQTRPVLLNSWEALHFDYNATSILELARESAS
LGVKLFVLDDGWFGVQHPRVDDASGLGDWQVNPDKFPDGLGALVETITALDTSDSASRRTLEFGLWFEPEMVNVN
STLYEKHPDWVLHAGDYPRTERRHQLVLNVALPEVQEFIIESLSGILSQSNISYVKWDNNRGIHETPSPSTHHAY
MLGLYRVFETLTRRFPHVLWEGCASGGGRFDAGVLHYFAQIWTSDDTDGLERLNIQFGTSLAYPPSAMGAHVSAV
PNEQTGRTTPLEFRAHVAMMGGSFGLELNPNDLVAADKAKVPELIALAEKVGPLVVAGDMWRLGLPEETNWPAAL
FISSDGRQAVLFYFQLRANINNSRPLVRLQGLDAKAQYQVDGQQVISGATLMNKGVSYRLEGDFGSKVVMLVKLQ
HEAL*
Coding >OphauG2|1559
ATGGCATCGCCGTCCTTGTGCCAGCTAGCTGTGGTGTTGGTGGTGTTGGGTCTGACTGGCGTCTGGTGTAACGAC
CGTCAAGACTTAGCAGAGCCCATCGTTGTTGACGGATCCTCCTTTGCCCTCAATGGCGCCCGCGTCTCGTACCGA
TTCCATGTGGACAACACCTCAGGAGACCTCATATCGGACCACTTTGGAGCATCCGTCGATGGAGACAGCATCGAG
GCTGAGCTTGACCCCATCCATGGCTGGGTGGGCATGATTGGCAGAGTCAGGCGTGAATTTCCAGACCAAGACCGT
GGCGACTTTCGAACTCCAGCAGTTCGCATACGCCAAACCCAAGGTTACACTGTCAGCAGCTTCCGCTACCAGTCC
CATCAAGTCACCACCGGAAAGCCCTCGCTCCAGGGCTTGCCCTCGACCTTTGGTACCGACGACCAGGCGTCCACA
CTCACTATACATTTGTGGGATGAATATAGCTCTGTCGCGGCCGATTTGTCCTACTCAGTCTTCCCAGAATACGAT
GCCATTGTGCGTAGCACCGCCGTCACTAATAAAGGCAACTCGACCATCACCATTGAAAAGCTTCATAGTCTCAGC
GTTGATCTGCCACATGGAGACTACGACATGCTCCAGCTCAGGGGGGACTGGGCGCGAGAGGGCGTGAGAGTGCGC
CGCAAGGTTGATTTTGGAAGCCAGGGCTTCTGCAGCAGTGCCGGATACTCATCTCACTTCCACAACCCTTTTCTC
TCACTCCTCTCCCCGTTGACAACCGAGACACACGGCGAGGCCTGGGGCTTCTCTCTTATATACACTGGGTCATTC
TGTGTCGAGGTGGAGAAGGGATCCCAGGATCTGACCCGAGCCATGATGGGCCTTAACCCACATCAGCTTTCATGG
GTACTTGGGCCTGGAGAGAGCTTCGTCTCTCCGGAAGCAGTGGCTGTCTTTTCTGACGAGGGCATCGGAGCCATG
TCACGAAAGCTGCACCGCCTCTACAGGCACAATCTCATGAAGAGCAAGTTTGCACTGCAGACTCGACCAGTCCTG
CTCAACAGCTGGGAGGCACTCCACTTTGACTACAATGCAACGAGCATTCTGGAGCTAGCCCGCGAGTCGGCCAGC
CTAGGGGTCAAGCTTTTCGTGCTCGATGACGGGTGGTTTGGCGTCCAGCATCCCCGAGTTGATGACGCATCAGGC
TTGGGGGACTGGCAAGTGAATCCCGACAAATTCCCAGACGGCCTCGGAGCTCTAGTGGAGACGATTACAGCTCTC
GACACTAGTGACTCTGCATCGCGCCGTACCTTGGAGTTTGGACTGTGGTTTGAGCCCGAAATGGTCAATGTCAAT
TCGACCTTGTATGAGAAGCACCCAGATTGGGTGCTTCACGCGGGAGACTATCCACGCACAGAGAGACGCCATCAG
CTGGTGCTTAATGTGGCGCTGCCAGAGGTGCAGGAATTCATCATCGAGTCGCTCTCAGGCATCCTCAGCCAATCA
AACATTAGCTATGTTAAATGGGACAACAACCGGGGCATTCACGAAACGCCCAGCCCAAGCACCCATCATGCGTAC
ATGCTGGGCCTATATCGCGTCTTTGAGACTCTGACACGGCGATTCCCACATGTGTTATGGGAAGGCTGCGCCTCG
GGCGGCGGCAGGTTTGACGCGGGAGTCTTGCATTACTTTGCACAGATTTGGACATCAGACGACACAGACGGGCTG
GAGCGCCTCAATATCCAATTCGGCACCTCTCTAGCCTATCCGCCCTCTGCCATGGGGGCCCATGTGTCGGCAGTG
CCAAATGAGCAGACGGGGCGGACGACACCGCTTGAGTTTCGGGCACATGTGGCCATGATGGGAGGATCGTTTGGG
CTGGAGCTCAACCCCAACGACCTGGTGGCAGCAGACAAGGCCAAGGTGCCAGAGCTGATTGCGCTGGCAGAAAAG
GTTGGTCCCCTGGTGGTCGCGGGCGACATGTGGCGGCTTGGGCTTCCCGAGGAGACCAACTGGCCAGCGGCGCTC
TTCATATCCAGCGACGGGCGCCAGGCTGTTCTCTTCTACTTCCAGCTGCGGGCAAACATCAACAACTCGCGGCCC
TTGGTGCGGCTCCAGGGACTGGATGCCAAGGCTCAGTACCAGGTGGATGGGCAGCAAGTCATCTCGGGGGCGACG
CTGATGAACAAGGGCGTGTCGTACCGGCTTGAAGGAGACTTTGGCAGCAAGGTGGTGATGCTAGTCAAGCTCCAA
CATGAAGCTCTGTAA
Transcript >OphauG2|1559
ATGGCATCGCCGTCCTTGTGCCAGCTAGCTGTGGTGTTGGTGGTGTTGGGTCTGACTGGCGTCTGGTGTAACGAC
CGTCAAGACTTAGCAGAGCCCATCGTTGTTGACGGATCCTCCTTTGCCCTCAATGGCGCCCGCGTCTCGTACCGA
TTCCATGTGGACAACACCTCAGGAGACCTCATATCGGACCACTTTGGAGCATCCGTCGATGGAGACAGCATCGAG
GCTGAGCTTGACCCCATCCATGGCTGGGTGGGCATGATTGGCAGAGTCAGGCGTGAATTTCCAGACCAAGACCGT
GGCGACTTTCGAACTCCAGCAGTTCGCATACGCCAAACCCAAGGTTACACTGTCAGCAGCTTCCGCTACCAGTCC
CATCAAGTCACCACCGGAAAGCCCTCGCTCCAGGGCTTGCCCTCGACCTTTGGTACCGACGACCAGGCGTCCACA
CTCACTATACATTTGTGGGATGAATATAGCTCTGTCGCGGCCGATTTGTCCTACTCAGTCTTCCCAGAATACGAT
GCCATTGTGCGTAGCACCGCCGTCACTAATAAAGGCAACTCGACCATCACCATTGAAAAGCTTCATAGTCTCAGC
GTTGATCTGCCACATGGAGACTACGACATGCTCCAGCTCAGGGGGGACTGGGCGCGAGAGGGCGTGAGAGTGCGC
CGCAAGGTTGATTTTGGAAGCCAGGGCTTCTGCAGCAGTGCCGGATACTCATCTCACTTCCACAACCCTTTTCTC
TCACTCCTCTCCCCGTTGACAACCGAGACACACGGCGAGGCCTGGGGCTTCTCTCTTATATACACTGGGTCATTC
TGTGTCGAGGTGGAGAAGGGATCCCAGGATCTGACCCGAGCCATGATGGGCCTTAACCCACATCAGCTTTCATGG
GTACTTGGGCCTGGAGAGAGCTTCGTCTCTCCGGAAGCAGTGGCTGTCTTTTCTGACGAGGGCATCGGAGCCATG
TCACGAAAGCTGCACCGCCTCTACAGGCACAATCTCATGAAGAGCAAGTTTGCACTGCAGACTCGACCAGTCCTG
CTCAACAGCTGGGAGGCACTCCACTTTGACTACAATGCAACGAGCATTCTGGAGCTAGCCCGCGAGTCGGCCAGC
CTAGGGGTCAAGCTTTTCGTGCTCGATGACGGGTGGTTTGGCGTCCAGCATCCCCGAGTTGATGACGCATCAGGC
TTGGGGGACTGGCAAGTGAATCCCGACAAATTCCCAGACGGCCTCGGAGCTCTAGTGGAGACGATTACAGCTCTC
GACACTAGTGACTCTGCATCGCGCCGTACCTTGGAGTTTGGACTGTGGTTTGAGCCCGAAATGGTCAATGTCAAT
TCGACCTTGTATGAGAAGCACCCAGATTGGGTGCTTCACGCGGGAGACTATCCACGCACAGAGAGACGCCATCAG
CTGGTGCTTAATGTGGCGCTGCCAGAGGTGCAGGAATTCATCATCGAGTCGCTCTCAGGCATCCTCAGCCAATCA
AACATTAGCTATGTTAAATGGGACAACAACCGGGGCATTCACGAAACGCCCAGCCCAAGCACCCATCATGCGTAC
ATGCTGGGCCTATATCGCGTCTTTGAGACTCTGACACGGCGATTCCCACATGTGTTATGGGAAGGCTGCGCCTCG
GGCGGCGGCAGGTTTGACGCGGGAGTCTTGCATTACTTTGCACAGATTTGGACATCAGACGACACAGACGGGCTG
GAGCGCCTCAATATCCAATTCGGCACCTCTCTAGCCTATCCGCCCTCTGCCATGGGGGCCCATGTGTCGGCAGTG
CCAAATGAGCAGACGGGGCGGACGACACCGCTTGAGTTTCGGGCACATGTGGCCATGATGGGAGGATCGTTTGGG
CTGGAGCTCAACCCCAACGACCTGGTGGCAGCAGACAAGGCCAAGGTGCCAGAGCTGATTGCGCTGGCAGAAAAG
GTTGGTCCCCTGGTGGTCGCGGGCGACATGTGGCGGCTTGGGCTTCCCGAGGAGACCAACTGGCCAGCGGCGCTC
TTCATATCCAGCGACGGGCGCCAGGCTGTTCTCTTCTACTTCCAGCTGCGGGCAAACATCAACAACTCGCGGCCC
TTGGTGCGGCTCCAGGGACTGGATGCCAAGGCTCAGTACCAGGTGGATGGGCAGCAAGTCATCTCGGGGGCGACG
CTGATGAACAAGGGCGTGTCGTACCGGCTTGAAGGAGACTTTGGCAGCAAGGTGGTGATGCTAGTCAAGCTCCAA
CATGAAGCTCTGTAA
Gene >OphauG2|1559
ATGGCATCGCCGTCCTTGTGCCAGCTAGCTGTGGTGTTGGTGGTGTTGGGTCTGACTGGCGTCTGGTGTAACGAC
CGTCAAGACTTAGCAGAGCGTAGGTCGTAGGACGTAAGAATCTGGCCACTGCTGACAATAAATGCAGCCATCGTT
GTTGACGGATCCTCCTTTGCCCTCAATGGCGCCCGCGTCTCGTACCGATTCCATGTGGACAACACCTCAGGAGAC
CTCATATCGGACCACTTTGGAGCATCCGTCGATGGAGACAGCATCGAGGCTGAGCTTGACCCCATCCATGGCTGG
GTGGGCATGATTGGCAGAGTCAGGCGTGAATTTCCAGACCAAGACCGTGGCGACTTTCGAACTCCAGCAGTTCGC
ATACGCCAAACCCAAGGTTACACTGTCAGCAGCTTCCGCTACCAGTCCCATCAAGTCACCACCGGAAAGCCCTCG
CTCCAGGGCTTGCCCTCGACCTTTGGTACCGACGACCAGGCGTCCACACTCACTATACATTTGTGGGATGAATAT
AGCTCTGTCGCGGCCGATTTGTCCTACTCAGTCTTCCCAGAATACGATGCCATTGTGCGTAGCACCGCCGTCACT
AATAAAGGCAACTCGACCATCACCATTGAAAAGCTTCATAGTCTCAGCGTTGATCTGCCACATGGAGACTACGAC
ATGCTCCAGCTCAGGGGGGACTGGGCGCGAGAGGGCGTGAGAGTGCGCCGCAAGGTTGATTTTGGAAGCCAGGGG
TAAGCTAGTTTGGCCGCGGCTCCAGCAAAGTGCTTTCGACTTACGCCGTAACAGCTTCTGCAGCAGTGCCGGATA
CTCATCTCACTTCCACAACCCTTTTCTCTCACTCCTCTCCCCGTTGACAACCGAGACACACGGCGAGGCCTGGGG
CTTCTCTCTTATATACACTGGGTCATTCTGTGTCGAGGTGGAGAAGGGATCCCAGGATCTGACCCGAGCCATGAT
GGGCCTTAACCCACATCAGCTTTCATGGGTACTTGGGCCTGGAGAGAGCTTCGTCTCTCCGGAAGCAGTGGCTGT
CTTTTCTGACGAGGGCATCGGAGCCATGTCACGAAAGCTGCACCGCCTCTACAGGCACAATCTCATGAAGAGCAA
GTTTGCACTGCAGACTCGACCAGTCCTGCTCAACAGCTGGGAGGCACTCCACTTTGACTACAATGCAACGAGCAT
TCTGGAGCTAGCCCGCGAGTCGGCCAGCCTAGGGGTCAAGCTTTTCGTGCTCGATGACGGGTGGTTTGGCGTCCA
GCATCCCCGAGTTGATGACGCATCAGGCTTGGGGGACTGGCAAGTGAATCCCGACAAATTCCCAGACGGCCTCGG
AGCTCTAGTGGAGACGATTACAGCTCTCGACACTAGTGACTCTGCATCGCGCCGTACCTTGGAGTTTGGACTGTG
GTTTGAGCCCGAAATGGTCAATGTCAATTCGACCTTGTATGAGAAGCACCCAGATTGGGTGCTTCACGCGGGAGA
CTATCCACGCACAGAGAGACGCCATCAGCTGGTGCTTAATGTGGCGCTGCCAGAGGTGCAGGAATTCATCATCGA
GTCGCTCTCAGGCATCCTCAGCCAATCAAACATTAGCTATGTTAAATGGGACAACAACCGGGGCATTCACGAAAC
GCCCAGCCCAAGCACCCATCATGCGTACATGCTGGGCCTATATCGCGTCTTTGAGACTCTGACACGGCGATTCCC
ACATGTGTTATGGGAAGGCTGCGCCTCGGGCGGCGGCAGGTTTGACGCGGGAGTCTTGCATTACTTTGCACAGAT
TTGGACATCAGACGACACAGACGGGCTGGAGCGCCTCAATATCCAATTCGGCACCTCTCTAGCCTATCCGCCCTC
TGCCATGGGGGCCCATGTGTCGGCAGTGCCAAATGAGCAGACGGGGCGGACGACACCGCTTGAGTTTCGGGCACA
TGTGGCCATGATGGGAGGATCGTTTGGGCTGGAGCTCAACCCCAACGACCTGGTGGCAGCAGACAAGGCCAAGGT
GCCAGAGCTGATTGCGCTGGCAGAAAAGGTTGGTCCCCTGGTGGTCGCGGGCGACATGTGGCGGCTTGGGCTTCC
CGAGGAGACCAACTGGCCAGCGGCGCTCTTCATATCCAGCGACGGGCGCCAGGCTGTTCTCTTCTACTTCCAGCT
GCGGGCAAACATCAACAACTCGCGGCCCTTGGTGCGGCTCCAGGGACTGGATGCCAAGGCTCAGTACCAGGTGGA
TGGGCAGCAAGTCATCTCGGGGGCGACGCTGATGAACAAGGGCGTGTCGTACCGGCTTGAAGGAGACTTTGGCAG
CAAGGTGGTGATGCTAGTCAAGCTCCAACATGAAGCTCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail