Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1553
Gene name
LocationContig_1479:35..1343
Strand+
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6035
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1553 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|2977
Ophiocordyceps subramaniannii Hirsu2|1376
Ophiocordyceps subramaniannii Hirsu2|2246
Ophiocordyceps subramaniannii Hirsu2|6027

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1553
MAQLVEGPSDLAKNVEDVLESNPSIVDQNFVEQFDNLYKGPLQNSDFKSKKMVIVIDALDECDSKTEISNLLEEL
SKPLYYKQNGKDTPVKYFLTGRHGGHSLSQDQIKNCHNRDLEDLTKETIRDDIESFLKFRLQRVPRLWENDEDPW
ANAKNVDTLGQLVTKACPLFEFAATACRLIEDDDLPEDPRSRLLDILATKCNGDLDHLYRTVLNKRFRSSNDNIA
PPRQKQVEDQFRRVIGSVMSLADPVSASCLAHLLGEKKSTVDDELRHFKSVLDIPSNDDGVIKIFHESFRDFFHG
SAQGEFGLDERKTHENLALRCRVLLCGKDGNKDALRKNFCELESPGAYRREIPEEVLCESISPEIQYACRFWVHH
LKNSNDKIKDNDAWYQLLYKHFLHWLEALGLLGRILESVQSVRELQTLVEVSCDALFDVI*
Coding >OphauG2|1553
ATGGCTCAGCTAGTGGAAGGACCGTCAGACCTTGCCAAGAATGTCGAGGATGTCTTGGAATCTAACCCTTCGATT
GTTGATCAAAATTTCGTGGAACAATTCGATAATCTTTATAAAGGACCTTTGCAAAACTCCGATTTTAAATCCAAA
AAAATGGTAATTGTCATTGACGCTCTGGACGAATGTGATTCAAAGACGGAAATCTCGAATCTGTTAGAAGAGCTC
TCGAAGCCTCTTTATTACAAGCAAAATGGAAAAGACACCCCAGTCAAATATTTCCTGACGGGTCGGCATGGCGGC
CACTCCCTGTCGCAAGACCAGATCAAAAACTGCCACAATCGGGATCTTGAGGATCTCACCAAGGAAACCATTAGG
GATGACATTGAAAGTTTCTTGAAATTTCGACTCCAAAGGGTCCCACGTCTCTGGGAGAACGATGAGGATCCTTGG
GCCAATGCCAAAAACGTTGATACCCTCGGTCAATTGGTCACCAAAGCCTGTCCGTTATTCGAATTCGCAGCCACG
GCCTGTCGCTTGATTGAGGATGACGATCTTCCAGAAGATCCCAGATCCCGTCTCCTTGATATACTAGCCACCAAG
TGTAATGGAGACCTCGACCACCTATATCGGACGGTATTGAATAAAAGATTCCGCAGCTCCAACGATAACATTGCA
CCACCAAGGCAGAAACAGGTGGAGGATCAATTTCGTCGCGTTATTGGCTCAGTAATGAGCCTAGCGGATCCTGTT
TCGGCTTCATGTCTTGCCCACCTGTTGGGCGAAAAAAAGTCCACGGTCGACGATGAGCTACGGCACTTTAAATCA
GTTTTGGACATTCCATCGAATGATGATGGGGTTATCAAGATATTCCATGAATCATTTAGAGATTTTTTCCACGGG
TCGGCTCAAGGGGAGTTTGGACTTGATGAGCGAAAAACTCACGAGAATTTGGCACTTCGATGTCGTGTGCTTCTT
TGCGGAAAGGATGGCAACAAGGATGCTCTGCGCAAAAATTTCTGCGAGTTGGAGTCACCTGGAGCCTATAGAAGA
GAAATTCCCGAGGAAGTCCTTTGCGAGTCTATATCGCCAGAGATTCAGTATGCATGTCGATTTTGGGTTCACCAC
TTAAAAAACAGCAACGATAAGATTAAGGACAATGATGCTTGGTACCAACTACTTTATAAGCACTTCTTACACTGG
CTCGAGGCCCTTGGTCTCTTGGGCAGAATTTTGGAAAGCGTGCAGTCTGTCAGGGAGCTGCAAACCTTGGTAGAA
GTAAGTTGTGATGCCCTCTTTGATGTCATATAG
Transcript >OphauG2|1553
ATGGCTCAGCTAGTGGAAGGACCGTCAGACCTTGCCAAGAATGTCGAGGATGTCTTGGAATCTAACCCTTCGATT
GTTGATCAAAATTTCGTGGAACAATTCGATAATCTTTATAAAGGACCTTTGCAAAACTCCGATTTTAAATCCAAA
AAAATGGTAATTGTCATTGACGCTCTGGACGAATGTGATTCAAAGACGGAAATCTCGAATCTGTTAGAAGAGCTC
TCGAAGCCTCTTTATTACAAGCAAAATGGAAAAGACACCCCAGTCAAATATTTCCTGACGGGTCGGCATGGCGGC
CACTCCCTGTCGCAAGACCAGATCAAAAACTGCCACAATCGGGATCTTGAGGATCTCACCAAGGAAACCATTAGG
GATGACATTGAAAGTTTCTTGAAATTTCGACTCCAAAGGGTCCCACGTCTCTGGGAGAACGATGAGGATCCTTGG
GCCAATGCCAAAAACGTTGATACCCTCGGTCAATTGGTCACCAAAGCCTGTCCGTTATTCGAATTCGCAGCCACG
GCCTGTCGCTTGATTGAGGATGACGATCTTCCAGAAGATCCCAGATCCCGTCTCCTTGATATACTAGCCACCAAG
TGTAATGGAGACCTCGACCACCTATATCGGACGGTATTGAATAAAAGATTCCGCAGCTCCAACGATAACATTGCA
CCACCAAGGCAGAAACAGGTGGAGGATCAATTTCGTCGCGTTATTGGCTCAGTAATGAGCCTAGCGGATCCTGTT
TCGGCTTCATGTCTTGCCCACCTGTTGGGCGAAAAAAAGTCCACGGTCGACGATGAGCTACGGCACTTTAAATCA
GTTTTGGACATTCCATCGAATGATGATGGGGTTATCAAGATATTCCATGAATCATTTAGAGATTTTTTCCACGGG
TCGGCTCAAGGGGAGTTTGGACTTGATGAGCGAAAAACTCACGAGAATTTGGCACTTCGATGTCGTGTGCTTCTT
TGCGGAAAGGATGGCAACAAGGATGCTCTGCGCAAAAATTTCTGCGAGTTGGAGTCACCTGGAGCCTATAGAAGA
GAAATTCCCGAGGAAGTCCTTTGCGAGTCTATATCGCCAGAGATTCAGTATGCATGTCGATTTTGGGTTCACCAC
TTAAAAAACAGCAACGATAAGATTAAGGACAATGATGCTTGGTACCAACTACTTTATAAGCACTTCTTACACTGG
CTCGAGGCCCTTGGTCTCTTGGGCAGAATTTTGGAAAGCGTGCAGTCTGTCAGGGAGCTGCAAACCTTGGTAGAA
GTAAGTTGTGATGCCCTCTTTGATGTCATATAG
Gene >OphauG2|1553
ATGGCTCAGCTAGTGGAAGGACCGTCAGACCTTGCCAAGAATGTCGAGGATGTCTTGGAATCTAACCCTTCGATT
GTTGATCAAAATTTCGTGGAACAATTCGATAATCTTTATAAAGGACCTTTGCAAAACTCCGATTTTAAATCCAAA
AAAATGGTAATTGTCATTGACGCTCTGGACGAATGTGATTCAAAGACGGAAATCTCGAATCTGTTAGAAGAGCTC
TCGAAGCCTCTTTATTACAAGCAAAATGGAAAAGACACCCCAGTCAAATATTTCCTGACGGGTCGGCATGGCGGC
CACTCCCTGTCGCAAGACCAGATCAAAAACTGCCACAATCGGGATCTTGAGGATCTCACCAAGGAAACCATTAGG
GATGACATTGAAAGTTTCTTGAAATTTCGACTCCAAAGGGTCCCACGTCTCTGGGAGAACGATGAGGATCCTTGG
GCCAATGCCAAAAACGTTGATACCCTCGGTCAATTGGTCACCAAAGCCTGTCCGTTATTCGAATTCGCAGCCACG
GCCTGTCGCTTGATTGAGGATGACGATCTTCCAGAAGATCCCAGATCCCGTCTCCTTGATATACTAGCCACCAAG
TGTAATGGAGACCTCGACCACCTATATCGGACGGTATTGAATAAAAGATTCCGCAGCTCCAACGATAACATTGCA
CCACCAAGGCAGAAACAGGTGGAGGATCAATTTCGTCGCGTTATTGGCTCAGTAATGAGCCTAGCGGATCCTGTT
TCGGCTTCATGTCTTGCCCACCTGTTGGGCGAAAAAAAGTCCACGGTCGACGATGAGCTACGGCACTTTAAATCA
GTTTTGGACATTCCATCGAATGATGATGGGGTTATCAAGATATTCCATGAATCATTTAGAGATTTTTTCCACGGG
TCGGCTCAAGGGGAGTTTGGACTTGATGAGCGAAAAACTCACGAGAATTTGGCACTTCGATGTCGTGTGCTTCTT
TGCGGAAAGGATGGCAACAAGGATGCTCTGCGCAAAAATTTCTGCGAGTTGGAGTCACCTGGAGCCTATAGAAGA
GAAATTCCCGAGGAAGTCCTTTGCGAGTCTATATCGCCAGAGATTCAGTATGCATGTCGATTTTGGGTTCACCAC
TTAAAAAACAGCAACGATAAGATTAAGGACAATGATGCTTGGTACCAACTACTTTATAAGCACTTCTTACACTGG
CTCGAGGCCCTTGGTCTCTTGGGCAGAATTTTGGAAAGCGTGCAGTCTGTCAGGGAGCTGCAAACCTTGGTAGAA
GTAAGTTGTGATGCCCTCTTTGATGTCATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail