Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1545
Gene name
LocationContig_1473:109..3188
Strand-
Gene length (bp)3079
Transcript length (bp)2982
Coding sequence length (bp)2982
Protein length (aa) 994

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 4.5E-189 625 983
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.1E-06 823 978

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 983 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 84 983 0.0E+00
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 77 983 0.0E+00
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 91 983 0.0E+00
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 77 983 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 983 0.0E+00
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 84 983 0.0E+00
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 77 983 0.0E+00
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 91 983 0.0E+00
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 77 983 0.0E+00
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 39 983 0.0E+00
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1 983 0.0E+00
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 202 983 4.0E-155
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 201 983 2.0E-154
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 647 983 2.0E-96
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 646 983 3.0E-86
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 646 983 1.0E-83
sp|P04340|NODC_RHILV N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae GN=nodC PE=3 SV=1 811 983 1.0E-12
sp|Q07755|NODC_AZOC5 N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodC PE=3 SV=2 796 977 7.0E-11
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 813 979 1.0E-10
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 823 984 1.0E-09
sp|P50357|NODC_RHISN N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain NGR234) GN=nodC PE=3 SV=2 813 979 2.0E-09
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 815 977 3.0E-09
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 822 977 9.0E-09
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 822 977 1.0E-08
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 825 983 1.0E-08
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 822 977 2.0E-08
sp|P70312|HYAS2_MOUSE Hyaluronan synthase 2 OS=Mus musculus GN=Has2 PE=1 SV=4 806 904 3.0E-08
sp|O00219|HYAS3_HUMAN Hyaluronan synthase 3 OS=Homo sapiens GN=HAS3 PE=2 SV=3 806 980 3.0E-08
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 822 978 3.0E-08
sp|Q92819|HYAS2_HUMAN Hyaluronan synthase 2 OS=Homo sapiens GN=HAS2 PE=2 SV=1 806 904 3.0E-08
sp|O97711|HYAS2_BOVIN Hyaluronan synthase 2 OS=Bos taurus GN=HAS2 PE=2 SV=1 806 904 3.0E-08
sp|O35776|HYAS2_RAT Hyaluronan synthase 2 OS=Rattus norvegicus GN=Has2 PE=2 SV=1 806 904 3.0E-08
sp|G5AY81|HYAS2_HETGA Hyaluronan synthase 2 OS=Heterocephalus glaber GN=Has2 PE=3 SV=1 806 904 3.0E-08
sp|Q92839|HYAS1_HUMAN Hyaluronan synthase 1 OS=Homo sapiens GN=HAS1 PE=1 SV=2 806 983 4.0E-08
sp|Q61647|HYAS1_MOUSE Hyaluronan synthase 1 OS=Mus musculus GN=Has1 PE=1 SV=1 806 983 5.0E-08
sp|O08650|HYAS3_MOUSE Hyaluronan synthase 3 OS=Mus musculus GN=Has3 PE=1 SV=2 806 980 7.0E-08
sp|O57424|HYAS2_CHICK Hyaluronan synthase 2 OS=Gallus gallus GN=HAS2 PE=2 SV=2 821 904 8.0E-08
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 815 977 8.0E-08
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 767 977 2.0E-07
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 822 910 3.0E-07
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 823 977 3.0E-07
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 822 977 7.0E-07
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 815 977 8.0E-07
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 822 978 1.0E-06
sp|O57427|HYAS2_XENLA Hyaluronan synthase 2 OS=Xenopus laevis GN=has2 PE=2 SV=2 806 904 1.0E-06
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 822 978 2.0E-06
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 822 979 3.0E-06
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 823 907 3.0E-06
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 822 977 3.0E-06
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 823 984 4.0E-06
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 823 985 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 237 259 22
2 500 522 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1545
MSLPERPGASPRLDRGTWYRQSPSGAARPGDVEATGHGGMSKGGRHGRGRSASSIGDSISNANANTDKMPLSPTG
PGGSAGDGGSEQGMSRKRSLVRPERKRIGKDHRHYHYHKHASNMDVLPSPTGNEAAMEELDSSTEPWGRTNESVS
SWAGQAWRKEAEKAQRRKSGKIVKAGKRRQETWRRSSNKKQASEEQLGPPSFWNLYCAGVTFWCPDFVLKWFGKP
TKAQRRAWREKMGLISIILSIMAVVGFLTFGFTATVCSAPPLRLQVNKVSEGFMIFHGVAYDLGNSHHPPAEGIP
LRQDGLGANVLYDLGEKHGGQDGSFLFQNVNGRCKGLITAAEGSDVPTNDEGGVAWYFPCTTVNQDGSTEPNLTV
GYYLGYGCHTTANARNAFYLDLAKAADVYFTWEDIGNASRNLMVYSGSVLDLDLLRWFNDSQVSVPPRFRELRER
GSAANAAVRGRDVTRMMQAGDDKAYAQCLEDIVKVGSVDTETVGCIASKVVLYCALTLILSVVLARFALALVFQW
FISRHYGAAKTSQSSDRRKRNRQIEAWSDDIYRAPVRLPGDVGSTVVGSDRSRRTASFLPTTSRFSAVYAAGARR
QPTTMASQGAASSLMASSPADASPHDAVVPQPPCDWMPFGFPLAHTMCLVTAYSEGADGIRTTLDSIATTDYPNS
HKAIVVICDGIIKGKGEAQSTPDVCLAMLKDHATPPHLVQPFSYVAVASGAKRHNMAKVYCGFYDYGPASQIPPD
RHQRVPMMVIVKCGTPQEAAQPKPGNRGKRDSQIILMSFLQKVMFDERMTELEYHMFNGLRAVTAISPDFYEIVL
MVDADTKVFPDSLTHMVSAMVKDPEIMGLCGETKIANKRDSWVTAIQVFEYFISHHLAKSFESIFGGVTCLPGCF
CMYRIKAPKGGHNYWVPILANPDIVEHYSENVVETLHEKNLYLLGEDRFLTTLMLRTFPKRKQVFVPQAVCKTTV
PDKFMVLLLSFLSRSSAP*
Coding >OphauG2|1545
ATGTCTTTACCCGAGAGACCTGGGGCAAGTCCTCGGCTTGACCGCGGGACCTGGTATCGCCAGTCTCCCTCTGGC
GCGGCTCGACCTGGCGACGTGGAAGCGACAGGCCATGGCGGCATGTCCAAGGGCGGGCGGCATGGGCGTGGCAGG
TCTGCGTCGTCGATTGGCGACAGCATCTCTAATGCCAATGCCAACACGGACAAGATGCCTCTGTCGCCGACGGGG
CCGGGCGGCAGCGCAGGGGATGGAGGGTCGGAGCAGGGCATGTCGCGCAAAAGGAGCCTGGTGCGGCCCGAGAGA
AAGAGGATAGGAAAGGACCATCGGCACTACCACTACCACAAGCATGCCAGCAACATGGACGTGCTGCCGTCGCCA
ACGGGCAACGAGGCAGCAATGGAGGAGCTGGACAGCTCGACGGAGCCGTGGGGGCGGACCAATGAGAGCGTGTCG
TCATGGGCTGGGCAGGCATGGAGAAAGGAGGCTGAAAAGGCGCAAAGACGCAAGTCGGGCAAGATTGTCAAGGCG
GGCAAGAGGCGGCAGGAGACGTGGCGCAGGAGCAGCAACAAGAAGCAGGCGTCGGAGGAGCAGCTGGGGCCGCCG
AGCTTCTGGAACCTGTACTGCGCGGGGGTGACGTTTTGGTGCCCCGACTTTGTGCTCAAGTGGTTTGGCAAGCCG
ACCAAGGCGCAGCGGCGGGCATGGCGGGAAAAGATGGGGCTCATCAGCATCATCCTCAGCATCATGGCGGTGGTG
GGCTTCTTGACGTTTGGCTTCACGGCAACGGTGTGCAGCGCGCCGCCGCTGCGGCTGCAGGTCAACAAGGTGTCG
GAGGGCTTCATGATCTTCCACGGGGTGGCGTACGACCTGGGCAACTCGCACCACCCGCCGGCCGAGGGCATCCCG
CTGCGGCAGGACGGGCTCGGGGCCAACGTGCTGTACGACCTGGGCGAGAAGCACGGGGGCCAGGACGGCAGCTTC
CTCTTCCAAAACGTCAACGGGCGGTGCAAGGGGCTGATTACGGCGGCCGAGGGCTCCGACGTGCCGACCAACGAC
GAGGGCGGCGTGGCGTGGTATTTCCCGTGCACCACGGTCAACCAGGACGGGTCGACGGAGCCCAACCTGACGGTG
GGCTACTACCTGGGCTACGGCTGCCACACGACGGCCAATGCGCGCAACGCCTTCTACCTGGACCTGGCCAAGGCG
GCCGACGTGTACTTTACGTGGGAGGACATTGGCAACGCGTCGCGCAACCTCATGGTGTACTCGGGCAGCGTGCTG
GACCTGGACCTGCTGCGCTGGTTCAACGACAGCCAGGTGAGCGTGCCGCCGCGCTTCCGGGAGCTGCGCGAGCGC
GGGTCGGCGGCCAACGCGGCGGTGCGCGGGCGCGACGTGACGCGCATGATGCAGGCGGGCGACGACAAGGCCTAC
GCGCAGTGCCTCGAGGACATTGTCAAGGTGGGCTCCGTCGACACGGAGACGGTGGGCTGCATCGCGTCCAAGGTG
GTGCTGTACTGCGCCCTGACGCTGATTCTGTCGGTGGTGCTGGCGCGCTTTGCCCTGGCGCTCGTCTTCCAGTGG
TTCATCAGCCGCCACTACGGCGCCGCCAAGACGTCGCAGAGCTCGGACCGCCGCAAGCGCAACCGCCAGATCGAG
GCCTGGAGCGACGACATCTACCGCGCGCCCGTGCGCCTGCCCGGCGACGTGGGCAGCACCGTGGTGGGCTCGGAC
CGCAGCCGCCGCACCGCCTCGTTTCTGCCCACCACGTCGCGCTTCTCGGCCGTCTACGCCGCCGGCGCCCGCCGC
CAGCCCACCACCATGGCCAGCCAGGGCGCCGCCTCGTCCCTCATGGCCTCGTCGCCCGCCGATGCCTCGCCCCAC
GACGCCGTGGTCCCCCAGCCGCCCTGCGACTGGATGCCCTTTGGCTTCCCCCTGGCCCACACCATGTGCCTCGTC
ACGGCCTACTCGGAGGGCGCCGACGGCATCCGCACCACGCTCGACTCCATTGCCACCACGGACTACCCCAACAGC
CACAAGGCCATTGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGCGAGGCCCAGTCCACCCCCGACGTGTGC
CTGGCCATGCTCAAGGACCACGCCACCCCCCCCCATCTGGTCCAGCCCTTTTCCTACGTGGCCGTGGCCAGCGGC
GCCAAGCGCCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTACGGCCCCGCCTCGCAGATCCCCCCCGAC
CGCCACCAGCGCGTCCCCATGATGGTGATTGTCAAGTGCGGCACCCCCCAAGAGGCCGCCCAGCCCAAGCCGGGC
AACCGCGGCAAGCGCGACAGCCAAATCATCCTCATGTCCTTTTTGCAAAAGGTCATGTTTGACGAGCGCATGACG
GAGCTCGAGTACCACATGTTCAACGGCCTGCGCGCCGTCACCGCCATCTCCCCCGACTTCTACGAAATCGTGCTC
ATGGTGGACGCCGACACAAAGGTCTTCCCCGACAGCCTGACTCACATGGTGTCCGCCATGGTCAAGGACCCCGAA
ATCATGGGCCTGTGCGGCGAGACCAAGATTGCAAACAAGCGCGACAGCTGGGTCACCGCCATCCAGGTCTTTGAG
TACTTCATCTCCCACCACCTGGCCAAGTCGTTTGAGTCCATTTTTGGCGGCGTCACCTGCCTGCCCGGCTGCTTT
TGCATGTACCGCATCAAGGCCCCCAAGGGCGGCCACAACTACTGGGTCCCCATTCTCGCCAACCCCGACATTGTC
GAGCACTATTCGGAAAACGTGGTGGAGACGCTGCACGAAAAGAACCTCTATCTGCTGGGCGAGGACCGCTTCCTG
ACCACGCTCATGCTGCGCACCTTTCCCAAGCGCAAGCAAGTCTTTGTGCCCCAGGCCGTCTGCAAGACCACCGTC
CCCGACAAGTTTATGGTGCTGCTTTTGTCCTTTTTGTCGCGTTCGTCGGCACCCTAG
Transcript >OphauG2|1545
ATGTCTTTACCCGAGAGACCTGGGGCAAGTCCTCGGCTTGACCGCGGGACCTGGTATCGCCAGTCTCCCTCTGGC
GCGGCTCGACCTGGCGACGTGGAAGCGACAGGCCATGGCGGCATGTCCAAGGGCGGGCGGCATGGGCGTGGCAGG
TCTGCGTCGTCGATTGGCGACAGCATCTCTAATGCCAATGCCAACACGGACAAGATGCCTCTGTCGCCGACGGGG
CCGGGCGGCAGCGCAGGGGATGGAGGGTCGGAGCAGGGCATGTCGCGCAAAAGGAGCCTGGTGCGGCCCGAGAGA
AAGAGGATAGGAAAGGACCATCGGCACTACCACTACCACAAGCATGCCAGCAACATGGACGTGCTGCCGTCGCCA
ACGGGCAACGAGGCAGCAATGGAGGAGCTGGACAGCTCGACGGAGCCGTGGGGGCGGACCAATGAGAGCGTGTCG
TCATGGGCTGGGCAGGCATGGAGAAAGGAGGCTGAAAAGGCGCAAAGACGCAAGTCGGGCAAGATTGTCAAGGCG
GGCAAGAGGCGGCAGGAGACGTGGCGCAGGAGCAGCAACAAGAAGCAGGCGTCGGAGGAGCAGCTGGGGCCGCCG
AGCTTCTGGAACCTGTACTGCGCGGGGGTGACGTTTTGGTGCCCCGACTTTGTGCTCAAGTGGTTTGGCAAGCCG
ACCAAGGCGCAGCGGCGGGCATGGCGGGAAAAGATGGGGCTCATCAGCATCATCCTCAGCATCATGGCGGTGGTG
GGCTTCTTGACGTTTGGCTTCACGGCAACGGTGTGCAGCGCGCCGCCGCTGCGGCTGCAGGTCAACAAGGTGTCG
GAGGGCTTCATGATCTTCCACGGGGTGGCGTACGACCTGGGCAACTCGCACCACCCGCCGGCCGAGGGCATCCCG
CTGCGGCAGGACGGGCTCGGGGCCAACGTGCTGTACGACCTGGGCGAGAAGCACGGGGGCCAGGACGGCAGCTTC
CTCTTCCAAAACGTCAACGGGCGGTGCAAGGGGCTGATTACGGCGGCCGAGGGCTCCGACGTGCCGACCAACGAC
GAGGGCGGCGTGGCGTGGTATTTCCCGTGCACCACGGTCAACCAGGACGGGTCGACGGAGCCCAACCTGACGGTG
GGCTACTACCTGGGCTACGGCTGCCACACGACGGCCAATGCGCGCAACGCCTTCTACCTGGACCTGGCCAAGGCG
GCCGACGTGTACTTTACGTGGGAGGACATTGGCAACGCGTCGCGCAACCTCATGGTGTACTCGGGCAGCGTGCTG
GACCTGGACCTGCTGCGCTGGTTCAACGACAGCCAGGTGAGCGTGCCGCCGCGCTTCCGGGAGCTGCGCGAGCGC
GGGTCGGCGGCCAACGCGGCGGTGCGCGGGCGCGACGTGACGCGCATGATGCAGGCGGGCGACGACAAGGCCTAC
GCGCAGTGCCTCGAGGACATTGTCAAGGTGGGCTCCGTCGACACGGAGACGGTGGGCTGCATCGCGTCCAAGGTG
GTGCTGTACTGCGCCCTGACGCTGATTCTGTCGGTGGTGCTGGCGCGCTTTGCCCTGGCGCTCGTCTTCCAGTGG
TTCATCAGCCGCCACTACGGCGCCGCCAAGACGTCGCAGAGCTCGGACCGCCGCAAGCGCAACCGCCAGATCGAG
GCCTGGAGCGACGACATCTACCGCGCGCCCGTGCGCCTGCCCGGCGACGTGGGCAGCACCGTGGTGGGCTCGGAC
CGCAGCCGCCGCACCGCCTCGTTTCTGCCCACCACGTCGCGCTTCTCGGCCGTCTACGCCGCCGGCGCCCGCCGC
CAGCCCACCACCATGGCCAGCCAGGGCGCCGCCTCGTCCCTCATGGCCTCGTCGCCCGCCGATGCCTCGCCCCAC
GACGCCGTGGTCCCCCAGCCGCCCTGCGACTGGATGCCCTTTGGCTTCCCCCTGGCCCACACCATGTGCCTCGTC
ACGGCCTACTCGGAGGGCGCCGACGGCATCCGCACCACGCTCGACTCCATTGCCACCACGGACTACCCCAACAGC
CACAAGGCCATTGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGCGAGGCCCAGTCCACCCCCGACGTGTGC
CTGGCCATGCTCAAGGACCACGCCACCCCCCCCCATCTGGTCCAGCCCTTTTCCTACGTGGCCGTGGCCAGCGGC
GCCAAGCGCCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTACGGCCCCGCCTCGCAGATCCCCCCCGAC
CGCCACCAGCGCGTCCCCATGATGGTGATTGTCAAGTGCGGCACCCCCCAAGAGGCCGCCCAGCCCAAGCCGGGC
AACCGCGGCAAGCGCGACAGCCAAATCATCCTCATGTCCTTTTTGCAAAAGGTCATGTTTGACGAGCGCATGACG
GAGCTCGAGTACCACATGTTCAACGGCCTGCGCGCCGTCACCGCCATCTCCCCCGACTTCTACGAAATCGTGCTC
ATGGTGGACGCCGACACAAAGGTCTTCCCCGACAGCCTGACTCACATGGTGTCCGCCATGGTCAAGGACCCCGAA
ATCATGGGCCTGTGCGGCGAGACCAAGATTGCAAACAAGCGCGACAGCTGGGTCACCGCCATCCAGGTCTTTGAG
TACTTCATCTCCCACCACCTGGCCAAGTCGTTTGAGTCCATTTTTGGCGGCGTCACCTGCCTGCCCGGCTGCTTT
TGCATGTACCGCATCAAGGCCCCCAAGGGCGGCCACAACTACTGGGTCCCCATTCTCGCCAACCCCGACATTGTC
GAGCACTATTCGGAAAACGTGGTGGAGACGCTGCACGAAAAGAACCTCTATCTGCTGGGCGAGGACCGCTTCCTG
ACCACGCTCATGCTGCGCACCTTTCCCAAGCGCAAGCAAGTCTTTGTGCCCCAGGCCGTCTGCAAGACCACCGTC
CCCGACAAGTTTATGGTGCTGCTTTTGTCCTTTTTGTCGCGTTCGTCGGCACCCTAG
Gene >OphauG2|1545
ATGTCTTTACCCGAGAGACCTGGGGCAAGTCCTCGGCTTGACCGCGGGACCTGGTATCGCCAGTCTCCCTCTGGC
GCGGCTCGACCTGGCGACGTGGAAGCGACAGGCCATGGCGGCATGTCCAAGGGCGGGCGGCATGGGCGTGGCAGG
TCTGCGTCGTCGATTGGCGACAGCATCTCTAATGCCAATGCCAACACGGACAAGATGCCTCTGTCGCCGACGGGG
CCGGGCGGCAGCGCAGGGGATGGAGGGTCGGAGCAGGGCATGTCGCGCAAAAGGAGCCTGGTGCGGCCCGAGAGA
AAGAGGATAGGAAAGGACCATCGGCACTACCACTACCACAAGCATGCCAGCAACATGGACGTGCTGCCGTCGCCA
ACGGGCAACGAGGCAGCAATGGAGGAGCTGGACAGCTCGACGGAGCCGTGGGGGCGGACCAATGAGAGCGTGTCG
TCATGGGCTGGGCAGGCATGGAGAAAGGAGGCTGAAAAGGCGCAAAGACGCAAGTCGGGCAAGATTGTCAAGGCG
GGCAAGAGGCGGCAGGAGACGTGGCGCAGGAGCAGCAACAAGAAGCAGGCGTCGGAGGAGCAGCTGGGGCCGCCG
AGCTTCTGGAACCTGTACTGCGCGGGGGTGACGTTTTGGTGCCCCGACTTTGTGCTCAAGTGGTTTGGCAAGCCG
ACCAAGGCGCAGCGGCGGGCATGGCGGGAAAAGATGGGGCTCATCAGCATCATCCTCAGCATCATGGCGGTGGTG
GGCTTCTTGACGTTTGGCTTCACGGCAACGGTGTGCAGCGCGCCGCCGCTGCGGCTGCAGGTCAACAAGGTGTCG
GAGGGCTTCATGATCTTCCACGGGGTGGCGTACGACCTGGGCAACTCGCACCACCCGCCGGCCGAGGGCATCCCG
CTGCGGCAGGACGGGCTCGGGGCCAACGTGCTGTACGACCTGGGCGAGAAGCACGGGGGCCAGGACGGCAGCTTC
CTCTTCCAAAACGTCAACGGGCGGTGCAAGGGGCTGATTACGGCGGCCGAGGGCTCCGACGTGCCGACCAACGAC
GAGGGCGGCGTGGCGTGGTATTTCCCGTGCACCACGGTCAACCAGGACGGGTCGACGGAGCCCAACCTGACGGTG
GGCTACTACCTGGGCTACGGCTGCCACACGACGGCCAATGCGCGCAACGCCTTCTACCTGGACCTGGCCAAGGCG
GCCGACGTGTACTTTACGTGGGAGGACATTGGCAACGCGTCGCGCAACCTCATGGTGTACTCGGGCAGCGTGCTG
GACCTGGACCTGCTGCGCTGGTTCAACGACAGCCAGGTGAGCGTGCCGCCGCGCTTCCGGGAGCTGCGCGAGCGC
GGGTCGGCGGCCAACGCGGCGGTGCGCGGGCGCGACGTGACGCGCATGATGCAGGCGGGCGACGACAAGGCCTAC
GCGCAGTGCCTCGAGGACATTGTCAAGGTGGGCTCCGTCGACACGGAGACGGTGGGCTGCATCGCGTCCAAGGTG
GTGCTGTACTGCGCCCTGACGCTGATTCTGTCGGTGGTGCTGGCGCGCTTTGCCCTGGCGCTCGTCTTCCAGTGG
TTCATCAGCCGCCACTACGGCGCCGCCAAGACGTCGCAGAGCTCGGACCGCCGCAAGCGCAACCGCCAGATCGAG
GCCTGGAGCGACGACATCTACCGCGCGCCCGTGCGCCTGCCCGGCGACGTGGGCAGCACCGTGGTGGGCTCGGAC
CGCAGCCGCCGCACCGCCTCGTTTCTGCCCACCACGTCGCGCTTCTCGGCCGTCTACGCCGCCGGCGCCCGCCGC
CAGCCCACCACCATGGCCAGCCAGGGCGCCGCCTCGTCCCTCATGGCCTCGTCGCCCGCCGATGCCTCGCCCCAC
GACGCCGTGGTCCCCCAGCCGCCCTGCGACTGGATGCCCTTTGGCTTCCCCCTGGCCCACACCATGTGCCTCGTC
ACGGCCTACTCGGAGGGCGCCGACGGCATCCGCACCACGCTCGACTCCATTGCCACCACGGACTACCCCAACAGC
CACAAGGCCATTGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGCGAGGCCCAGTCCACCCCCGACGTGTGC
CTGGCCATGCTCAAGGACCACGCCACCCCCCCCCATCTGGTCCAGCCCTTTTCCTACGTGGCCGTGGCCAGCGGC
GCCAAGCGCCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTACGGCCCCGCCTCGCAGATCCCCCCCGAC
CGCCACCAGCGCGTCCCCATGATGGTGATTGTCAAGTGCGGCACCCCCCAAGAGGCCGCCCAGCCCAAGCCGGGC
AACCGCGGCAAGCGCGACAGCCAAATCATCCTCATGTCCTTTTTGCAAAAGGTCATGTTTGACGAGCGCATGACG
GAGCTCGAGTACCACATGTTCAACGGCCTGCGCGCCGTCACCGCCATCTCCCCCGACTTCTACGAAATCGTGCTC
ATGGTGGACGCCGACACAAAGGTCTTCCCCGACAGCCTGACTCACATGGTGTCCGCCATGGTCAAGGACCCCGAA
ATCATGGGCCTGTGCGGCGAGACCAAGATTGCAAACAAGCGCGACAGCTGGGTCACCGCCATCCAGGTCTTTGAG
TACTTCATCTCCCACCACCTGGCCAAGTCGTTTGAGTCCATTTTTGGCGGCGTCACCTGCCTGCCCGGCTGCTTT
TGCATGTACCGCATCAAGGCCCCCAAGGGCGGCCACAACTACTGGGTCCCCATTCTCGCCAACCCCGACATTGTC
GAGCACTATTCGGAAAACGTGGTGGAGACGCTGCACGAAAAGAACCTCTATCTGCTGGGCGAGGACCGCTTCCTG
ACCACGCTCATGCTGCGCACCTTTCCCAAGCGCAAGCAAGTCTTTGTGCCCCAGGCCGTCTGCAAGACCACCGTC
CCCGACAAGTTTATGGTGCTGCTGTCCCAGCGCCGCCGCTGGATCAACTCCACCATTCCCATCCTCATGGAGCTG
GTCCTTTTGCGCGGCTTGTTCGGCACCTTTTGGTTTAGCATGCAGTTTGTCCTTTTTGTCGCGTTCGTCGGCACC
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail