Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1539
Gene name
LocationContig_147:14454..15946
Strand+
Gene length (bp)1492
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 4.2E-18 223 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 31 382 4.0E-40
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 31 382 9.0E-39
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 38 376 5.0E-26
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 40 360 3.0E-25
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 207 371 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 31 382 4.0E-40
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 31 382 9.0E-39
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 38 376 5.0E-26
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 40 360 3.0E-25
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 207 371 2.0E-15
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 224 385 2.0E-15
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 224 385 1.0E-14
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 193 371 1.0E-12
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 224 385 4.0E-12
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 224 383 5.0E-12
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 224 383 3.0E-10
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 224 383 5.0E-10
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 65 359 5.0E-10
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 224 371 7.0E-10
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 75 360 1.0E-09
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 224 384 2.0E-09
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 224 383 3.0E-09
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 224 383 1.0E-08
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 224 361 2.0E-08
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 89 359 4.0E-08
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 65 359 1.0E-07
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 89 359 1.0E-07
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 224 361 2.0E-07
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 221 331 1.0E-06
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 221 331 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1539
MSSVKPTKEPLSVDPAIATKPNNVDALPSLLKEINTGVYSLVSGEPPGVLSAILFGVDCGLWKLMAHNGQEIHKV
SELATALGVDTVLLSRFMRHLGTMGYLVEVDENEYKGTNFTKALSIPAIGNSYMAMVSGTIAGAIKFHEFSRQRA
WQNPTDARDTALMYACKTDKDMFAWLESQGYGTHFNDHMGGYSLGRIPWMDPAIFPVQEQLIAGAKKDPNSPFLV
DIGGSTGHDLLKFTSYFPKTPGRLILQDLPAVTRQIKGLDPCIQVISHNFFEEQPIKGARAYLLHSCLHDWPDSV
CETILTHVKNAMTPGYSKLLICEYVISKTNAHWEETALDMIMLADFSANERTIEAWHHLVEDKVGLKIANIWKSD
GGTQSLIECELA*
Coding >OphauG2|1539
ATGTCGAGTGTCAAGCCAACCAAGGAGCCACTCTCCGTCGACCCTGCCATCGCCACCAAACCCAACAATGTCGAC
GCACTTCCGAGTTTATTAAAGGAAATCAACACTGGAGTTTACTCACTCGTTTCTGGCGAACCGCCCGGAGTCTTG
TCTGCCATTTTATTTGGCGTCGACTGCGGATTATGGAAACTCATGGCACATAATGGGCAGGAGATTCACAAGGTG
TCCGAGCTGGCTACGGCTCTTGGTGTTGACACGGTGCTGCTCAGTCGATTTATGCGACATTTAGGCACAATGGGA
TACCTAGTCGAGGTCGACGAGAACGAGTACAAAGGCACAAACTTCACCAAAGCCTTGAGCATACCTGCCATTGGG
AATAGTTACATGGCCATGGTCTCGGGCACTATTGCCGGTGCAATCAAATTTCACGAATTTTCGCGCCAACGCGCA
TGGCAAAACCCCACGGATGCAAGGGATACGGCCTTGATGTACGCATGCAAGACAGATAAAGACATGTTTGCATGG
CTAGAGTCGCAGGGCTATGGCACTCACTTTAACGATCACATGGGCGGCTATAGTCTGGGACGAATCCCGTGGATG
GATCCTGCTATTTTCCCCGTCCAAGAGCAACTTATTGCTGGAGCAAAAAAGGACCCAAACTCACCATTTCTCGTG
GACATTGGTGGCAGCACTGGTCATGATCTTTTGAAATTTACGAGTTATTTCCCAAAGACTCCAGGGAGGCTGATC
CTTCAGGATCTTCCCGCAGTCACAAGGCAGATCAAAGGCCTAGACCCTTGCATCCAAGTCATAAGTCACAACTTT
TTCGAGGAGCAGCCTATCAAAGGTGCTCGCGCCTACCTATTGCACAGTTGCCTACACGACTGGCCCGATTCTGTA
TGCGAGACTATTCTTACCCACGTGAAAAATGCCATGACTCCTGGCTATAGCAAACTACTTATATGCGAGTATGTC
ATTTCCAAGACAAACGCGCATTGGGAGGAAACCGCACTAGACATGATTATGTTGGCGGACTTTTCTGCAAATGAG
CGAACTATCGAAGCATGGCACCACTTGGTTGAGGACAAGGTTGGCCTGAAGATTGCCAATATCTGGAAGAGCGAT
GGGGGCACGCAAAGCCTGATTGAATGTGAGCTGGCTTGA
Transcript >OphauG2|1539
ATGTCGAGTGTCAAGCCAACCAAGGAGCCACTCTCCGTCGACCCTGCCATCGCCACCAAACCCAACAATGTCGAC
GCACTTCCGAGTTTATTAAAGGAAATCAACACTGGAGTTTACTCACTCGTTTCTGGCGAACCGCCCGGAGTCTTG
TCTGCCATTTTATTTGGCGTCGACTGCGGATTATGGAAACTCATGGCACATAATGGGCAGGAGATTCACAAGGTG
TCCGAGCTGGCTACGGCTCTTGGTGTTGACACGGTGCTGCTCAGTCGATTTATGCGACATTTAGGCACAATGGGA
TACCTAGTCGAGGTCGACGAGAACGAGTACAAAGGCACAAACTTCACCAAAGCCTTGAGCATACCTGCCATTGGG
AATAGTTACATGGCCATGGTCTCGGGCACTATTGCCGGTGCAATCAAATTTCACGAATTTTCGCGCCAACGCGCA
TGGCAAAACCCCACGGATGCAAGGGATACGGCCTTGATGTACGCATGCAAGACAGATAAAGACATGTTTGCATGG
CTAGAGTCGCAGGGCTATGGCACTCACTTTAACGATCACATGGGCGGCTATAGTCTGGGACGAATCCCGTGGATG
GATCCTGCTATTTTCCCCGTCCAAGAGCAACTTATTGCTGGAGCAAAAAAGGACCCAAACTCACCATTTCTCGTG
GACATTGGTGGCAGCACTGGTCATGATCTTTTGAAATTTACGAGTTATTTCCCAAAGACTCCAGGGAGGCTGATC
CTTCAGGATCTTCCCGCAGTCACAAGGCAGATCAAAGGCCTAGACCCTTGCATCCAAGTCATAAGTCACAACTTT
TTCGAGGAGCAGCCTATCAAAGGTGCTCGCGCCTACCTATTGCACAGTTGCCTACACGACTGGCCCGATTCTGTA
TGCGAGACTATTCTTACCCACGTGAAAAATGCCATGACTCCTGGCTATAGCAAACTACTTATATGCGAGTATGTC
ATTTCCAAGACAAACGCGCATTGGGAGGAAACCGCACTAGACATGATTATGTTGGCGGACTTTTCTGCAAATGAG
CGAACTATCGAAGCATGGCACCACTTGGTTGAGGACAAGGTTGGCCTGAAGATTGCCAATATCTGGAAGAGCGAT
GGGGGCACGCAAAGCCTGATTGAATGTGAGCTGGCTTGA
Gene >OphauG2|1539
ATGTCGAGTGTCAAGCCAACCAAGGAGCCACTCTCCGTCGACCCTGCCATCGCCACCAAACCCAACAATGTCGAC
GCACTTCCGAGTTTATTAAAGGAAATCAACACTGGAGTTTACTCACTCGTTTCTGGCGAACCGGTTGATTCAAAC
CAGCTCTTGGTAAAATGCCGTTTGCTAGTTCAAGCTCTGGAAACTCCCCGTCAAACCATGATCAATCACTGCTGG
GCCCAGGCATGTATAACGCACCCTGAGTAACTAAGATCCCTACTTACATGATTAGCCCGGAGTCTTGTCTGCCAT
TTTATTTGGCGTCGACTGCGGATTATGGAAACTCATGGCACATAATGGGCAGGAGATTCACAAGGTGTCCGAGCT
GGCTACGGCTCTTGGTGTTGACACGGTGCTGCTCAGTAAGTAGACGCTTGACTCGATTTGACAATTTCAGAGCTC
AAGTTGCTAACCATTTCTTCCTCTAGGTCGATTTATGCGACATTTAGGCACAATGGGATACCTAGTCGAGGTCGA
CGAGAACGAGTACAAAGGCACAAACTTCACCAAAGCCTTGAGCATACCTGCCATTGGGAATAGTTACATGGCCAT
GTAGGTCTTGGACTGCACAATGCAGCCACGAGCCTCACTAGTCGCTGACCGCCCCCAAGGGTCTCGGGCACTATT
GCCGGTGCAATCAAATTTCACGAATTTTCGCGCCAACGCGCATGGCAAAACCCCACGGATGCAAGGGATACGGCC
TTGATGTACGCATGCAAGACAGATAAAGACATGTTTGCATGGCTAGAGTCGCAGGGCTATGGCACTCACTTTAAC
GATCACATGGGCGGCTATAGTCTGGGACGAATCCCGTGGATGGATCCTGCTATTTTCCCCGTCCAAGAGCAACTT
ATTGCTGGAGCAAAAAAGGACCCAAACTCACCATTTCTCGTGGACATTGGTGGCAGCACTGGTCATGATCTTTTG
AAATTTACGAGTTATTTCCCAAAGACTCCAGGGAGGCTGATCCTTCAGGATCTTCCCGCAGTCACAAGGCAGATC
AAAGGCCTAGACCCTTGCATCCAAGTCATAAGTCACAACTTTTTCGAGGAGCAGCCTATCAAAGGTGCAGAATTA
ATTTATAATTTTTCATTTATACATTATACAAGAGGCTGATATTCTTTTAGGTGCTCGCGCCTACCTATTGCACAG
TTGCCTACACGACTGGCCCGATTCTGTATGCGAGACTATTCTTACCCACGTGAAAAATGCCATGACTCCTGGCTA
TAGCAAACTACTTATATGCGAGTATGTCATTTCCAAGACAAACGCGCATTGGGAGGAAACCGCACTAGACATGAT
TATGTTGGCGGACTTTTCTGCAAATGAGCGAACTATCGAAGCATGGCACCACTTGGTTGAGGACAAGGTTGGCCT
GAAGATTGCCAATATCTGGAAGAGCGATGGGGGCACGCAAAGCCTGATTGAATGTGAGCTGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail