Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|152
Gene name
LocationContig_1020:3487..4994
Strand+
Gene length (bp)1507
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06071 YchF-GTPase_C Protein of unknown function (DUF933) 9.8E-35 307 389
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.7E-15 24 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38219|OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLA1 PE=1 SV=1 1 393 0.0E+00
sp|O13998|OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.03c PE=1 SV=1 1 390 0.0E+00
sp|Q9SA73|OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana GN=YchF1 PE=1 SV=1 1 394 3.0E-140
sp|Q6Z1J6|OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica GN=YchF1 PE=1 SV=1 1 394 1.0E-138
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 1 394 8.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38219|OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLA1 PE=1 SV=1 1 393 0.0E+00
sp|O13998|OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.03c PE=1 SV=1 1 390 0.0E+00
sp|Q9SA73|OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana GN=YchF1 PE=1 SV=1 1 394 3.0E-140
sp|Q6Z1J6|OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica GN=YchF1 PE=1 SV=1 1 394 1.0E-138
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 1 394 8.0E-138
sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1 PE=2 SV=1 1 388 2.0E-126
sp|P91917|OLA1_CAEEL Obg-like ATPase 1 OS=Caenorhabditis elegans GN=ola-1 PE=3 SV=1 1 394 9.0E-126
sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=2 SV=1 1 388 1.0E-125
sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1 PE=2 SV=1 1 388 1.0E-125
sp|Q8SWU7|OLA1_DROME Obg-like ATPase 1 OS=Drosophila melanogaster GN=CG1354 PE=1 SV=1 1 394 2.0E-125
sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis GN=ola1 PE=2 SV=1 1 388 2.0E-125
sp|A0JPJ7|OLA1_RAT Obg-like ATPase 1 OS=Rattus norvegicus GN=Ola1 PE=2 SV=1 1 388 3.0E-125
sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 PE=1 SV=2 1 388 6.0E-125
sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus GN=Ola1 PE=1 SV=1 1 388 8.0E-125
sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 PE=2 SV=1 1 388 1.0E-123
sp|Q7ZU42|OLA1_DANRE Obg-like ATPase 1 OS=Danio rerio GN=ola1 PE=2 SV=1 1 388 2.0E-123
sp|O14078|YEAD_SCHPO Obg-like ATPase homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.13c PE=3 SV=1 14 388 6.0E-116
sp|P38746|YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLF2 PE=1 SV=1 11 393 3.0E-110
sp|Q9CP90|YCHF_PASMU Ribosome-binding ATPase YchF OS=Pasteurella multocida (strain Pm70) GN=ychF PE=3 SV=3 21 385 1.0E-87
sp|P0ABU4|YCHF_SHIFL Ribosome-binding ATPase YchF OS=Shigella flexneri GN=ychF PE=3 SV=2 21 385 8.0E-87
sp|P0ABU2|YCHF_ECOLI Ribosome-binding ATPase YchF OS=Escherichia coli (strain K12) GN=ychF PE=1 SV=2 21 385 8.0E-87
sp|P0ABU3|YCHF_ECO57 Ribosome-binding ATPase YchF OS=Escherichia coli O157:H7 GN=ychF PE=3 SV=2 21 385 8.0E-87
sp|P44681|YCHF_HAEIN Ribosome-binding ATPase YchF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ychF PE=1 SV=2 21 385 5.0E-85
sp|Q7VMI2|YCHF_HAEDU Ribosome-binding ATPase YchF OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ychF PE=3 SV=3 21 385 1.0E-84
sp|P37518|YCHF_BACSU Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) GN=ychF PE=3 SV=1 21 385 2.0E-76
sp|P47270|YCHF_MYCGE Ribosome-binding ATPase YchF OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ychF PE=3 SV=1 21 384 2.0E-70
sp|Q8K9V2|YCHF_BUCAP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ychF PE=3 SV=3 21 385 4.0E-66
sp|P57288|YCHF_BUCAI Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ychF PE=3 SV=3 21 385 1.0E-65
sp|P75088|YCHF_MYCPN Ribosome-binding ATPase YchF OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ychF PE=3 SV=1 21 375 1.0E-60
sp|Q89AR6|YCHF_BUCBP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ychF PE=3 SV=3 21 385 5.0E-59
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 24 162 3.0E-11
sp|A5IKX2|OBG_THEP1 GTPase Obg OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=obg PE=3 SV=1 24 201 2.0E-10
sp|Q9WXV3|OBG_THEMA GTPase Obg OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=obg PE=3 SV=1 24 152 2.0E-10
sp|P42942|YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR210C PE=1 SV=1 24 153 2.0E-10
sp|B1LA53|OBG_THESQ GTPase Obg OS=Thermotoga sp. (strain RQ2) GN=obg PE=3 SV=1 24 152 3.0E-10
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 24 159 9.0E-10
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 14 151 9.0E-10
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 24 152 9.0E-10
sp|Q58728|Y1332_METJA Uncharacterized GTP-binding protein MJ1332 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1332 PE=3 SV=1 24 145 1.0E-09
sp|B1XT35|OBG_POLNS GTPase Obg OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=obg PE=3 SV=1 24 161 3.0E-09
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 24 151 4.0E-09
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 24 158 4.0E-09
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 24 170 5.0E-09
sp|Q24SP0|OBG_DESHY GTPase Obg OS=Desulfitobacterium hafniense (strain Y51) GN=obg PE=3 SV=1 24 152 7.0E-09
sp|O94362|YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.15 PE=3 SV=1 18 123 8.0E-09
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 24 123 8.0E-09
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 24 175 9.0E-09
sp|A4SVA3|OBG_POLSQ GTPase Obg OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=obg PE=3 SV=1 24 161 9.0E-09
sp|C0QUB5|OBG_PERMH GTPase Obg OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=obg PE=3 SV=1 24 161 1.0E-08
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 23 162 2.0E-08
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 24 151 2.0E-08
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 25 151 2.0E-08
sp|A5CR32|OBG_CLAM3 GTPase Obg OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=obg PE=3 SV=1 25 151 3.0E-08
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 24 151 4.0E-08
sp|A0JXJ8|OBG_ARTS2 GTPase Obg OS=Arthrobacter sp. (strain FB24) GN=obg PE=3 SV=1 25 151 4.0E-08
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 24 153 4.0E-08
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 24 153 4.0E-08
sp|B8FUR9|OBG_DESHD GTPase Obg OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=obg PE=3 SV=1 24 152 4.0E-08
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 24 161 4.0E-08
sp|A1R787|OBG_ARTAT GTPase Obg OS=Arthrobacter aurescens (strain TC1) GN=obg PE=3 SV=1 25 151 5.0E-08
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 25 151 5.0E-08
sp|B8H9P2|OBG_ARTCA GTPase Obg OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=obg PE=3 SV=1 25 202 5.0E-08
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 24 161 5.0E-08
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 24 183 5.0E-08
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 24 161 6.0E-08
sp|A0LSX1|OBG_ACIC1 GTPase Obg OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=obg PE=3 SV=1 25 151 6.0E-08
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 24 161 6.0E-08
sp|A1TTD3|OBG_ACIAC GTPase Obg OS=Acidovorax citrulli (strain AAC00-1) GN=obg PE=3 SV=1 6 161 7.0E-08
sp|A1KWG2|OBG_NEIMF GTPase Obg OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=obg PE=3 SV=1 24 161 7.0E-08
sp|Q9JXE5|OBG_NEIMB GTPase Obg OS=Neisseria meningitidis serogroup B (strain MC58) GN=obg PE=3 SV=1 24 161 7.0E-08
sp|A1IPH6|OBG_NEIMA GTPase Obg OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=obg PE=3 SV=1 24 161 8.0E-08
sp|B4RQP4|OBG_NEIG2 GTPase Obg OS=Neisseria gonorrhoeae (strain NCCP11945) GN=obg PE=3 SV=1 24 161 8.0E-08
sp|Q5F5D9|OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=obg PE=1 SV=1 24 161 8.0E-08
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 24 125 8.0E-08
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 3 151 8.0E-08
sp|A9M061|OBG_NEIM0 GTPase Obg OS=Neisseria meningitidis serogroup C (strain 053442) GN=obg PE=3 SV=1 24 161 8.0E-08
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 24 125 9.0E-08
sp|Q39QR4|OBG_GEOMG GTPase Obg OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 24 161 1.0E-07
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 24 176 1.0E-07
sp|A8MHK8|OBG_ALKOO GTPase Obg OS=Alkaliphilus oremlandii (strain OhILAs) GN=obg PE=3 SV=1 24 190 1.0E-07
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 24 155 1.0E-07
sp|Q043W1|OBG_LACGA GTPase Obg OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=obg PE=3 SV=1 24 135 2.0E-07
sp|Q7VZX6|OBG_BORPE GTPase Obg OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|Q7W1P2|OBG_BORPA GTPase Obg OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|Q7WQL8|OBG_BORBR GTPase Obg OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|Q04B11|OBG_LACDB GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=obg PE=3 SV=1 24 144 2.0E-07
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 24 153 2.0E-07
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 5 161 2.0E-07
sp|Q1GAM3|OBG_LACDA GTPase Obg OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=obg PE=3 SV=1 24 144 2.0E-07
sp|Q74JN7|OBG_LACJO GTPase Obg OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=obg PE=3 SV=1 24 135 2.0E-07
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 25 153 2.0E-07
sp|Q747Q2|OBG_GEOSL GTPase Obg OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|Q67SC6|OBG_SYMTH GTPase Obg OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 25 153 2.0E-07
sp|B2UCV3|OBG_RALPJ GTPase Obg OS=Ralstonia pickettii (strain 12J) GN=obg PE=3 SV=1 24 161 2.0E-07
sp|Q851Q6|OBGC2_ORYSJ Probable GTP-binding protein OBGC2 OS=Oryza sativa subsp. japonica GN=Os03g0799700 PE=2 SV=1 24 161 3.0E-07
sp|B3DPS4|OBG_BIFLD GTPase Obg OS=Bifidobacterium longum (strain DJO10A) GN=obg PE=3 SV=1 25 153 3.0E-07
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 24 178 3.0E-07
sp|A8YV14|OBG_LACH4 GTPase Obg OS=Lactobacillus helveticus (strain DPC 4571) GN=obg PE=3 SV=1 24 123 3.0E-07
sp|A1W4B0|OBG_ACISJ GTPase Obg OS=Acidovorax sp. (strain JS42) GN=obg PE=3 SV=2 24 161 3.0E-07
sp|Q5FKH5|OBG_LACAC GTPase Obg OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=obg PE=3 SV=1 24 123 3.0E-07
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 23 161 3.0E-07
sp|Q2SRV9|OBG_MYCCT GTPase Obg OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=obg PE=3 SV=1 24 203 3.0E-07
sp|Q022G3|OBG_SOLUE GTPase Obg OS=Solibacter usitatus (strain Ellin6076) GN=obg PE=3 SV=1 3 155 3.0E-07
sp|Q3A1D8|OBG_PELCD GTPase Obg OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|Q31CW3|OBG_PROM9 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9312) GN=obg PE=3 SV=1 24 152 4.0E-07
sp|Q6MTG9|OBG_MYCMS GTPase Obg OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=obg PE=3 SV=1 24 203 4.0E-07
sp|B1KZR3|OBG_CLOBM GTPase Obg OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=obg PE=3 SV=1 24 158 4.0E-07
sp|Q6KHM2|OBG_MYCMO GTPase Obg OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=obg PE=3 SV=1 24 162 4.0E-07
sp|B2SYV2|OBG_BURPP GTPase Obg OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=obg PE=3 SV=1 24 161 4.0E-07
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 24 181 5.0E-07
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 24 123 5.0E-07
sp|Q7V368|OBG_PROMP GTPase Obg OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=obg PE=3 SV=1 24 152 5.0E-07
sp|B1ILY5|OBG_CLOBK GTPase Obg OS=Clostridium botulinum (strain Okra / Type B1) GN=obg PE=3 SV=1 24 193 5.0E-07
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 24 158 5.0E-07
sp|Q31IT4|OBG_THICR GTPase Obg OS=Thiomicrospira crunogena (strain XCL-2) GN=obg PE=3 SV=1 24 151 5.0E-07
sp|B8DRN9|OBG_DESVM GTPase Obg OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=obg PE=3 SV=1 23 151 5.0E-07
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 24 161 5.0E-07
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 24 161 5.0E-07
sp|A5IYU8|OBG_MYCAP GTPase Obg OS=Mycoplasma agalactiae (strain PG2) GN=obg PE=3 SV=1 24 151 6.0E-07
sp|A5I666|OBG_CLOBH GTPase Obg OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=obg PE=3 SV=1 24 161 6.0E-07
sp|A7FXU6|OBG_CLOB1 GTPase Obg OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=obg PE=3 SV=1 24 161 6.0E-07
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 23 199 6.0E-07
sp|A9BP68|OBG_DELAS GTPase Obg OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=obg PE=3 SV=1 6 161 6.0E-07
sp|P44915|OBG_HAEIN GTPase Obg OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=obg PE=3 SV=1 24 151 6.0E-07
sp|B9MDZ7|OBG_ACIET GTPase Obg OS=Acidovorax ebreus (strain TPSY) GN=obg PE=3 SV=1 6 161 6.0E-07
sp|Q3SVI2|OBG_NITWN GTPase Obg OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=obg PE=3 SV=1 23 123 6.0E-07
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 24 153 6.0E-07
sp|Q3AF51|OBG_CARHZ GTPase Obg OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=obg PE=3 SV=1 24 163 6.0E-07
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 24 155 6.0E-07
sp|Q83ED8|OBG_COXBU GTPase Obg OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=obg PE=3 SV=1 24 123 7.0E-07
sp|A9KEJ7|OBG_COXBN GTPase Obg OS=Coxiella burnetii (strain Dugway 5J108-111) GN=obg PE=3 SV=1 24 123 7.0E-07
sp|B6J1S8|OBG_COXB2 GTPase Obg OS=Coxiella burnetii (strain CbuG_Q212) GN=obg PE=3 SV=1 24 123 7.0E-07
sp|A9NBL5|OBG_COXBR GTPase Obg OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=obg PE=3 SV=1 24 123 7.0E-07
sp|B6J9K2|OBG_COXB1 GTPase Obg OS=Coxiella burnetii (strain CbuK_Q154) GN=obg PE=3 SV=1 24 123 7.0E-07
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 24 153 7.0E-07
sp|Q29K06|GTPBA_DROPS GTP-binding protein 10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA10450 PE=3 SV=1 14 257 7.0E-07
sp|A9WUU2|OBG_RENSM GTPase Obg OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=obg PE=3 SV=1 25 151 7.0E-07
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 24 161 7.0E-07
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 24 152 7.0E-07
sp|Q7MYX6|OBG_PHOLL GTPase Obg OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=obg PE=3 SV=1 24 198 7.0E-07
sp|Q8XVL0|OBG_RALSO GTPase Obg OS=Ralstonia solanacearum (strain GMI1000) GN=obg PE=3 SV=1 24 161 7.0E-07
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 23 128 7.0E-07
sp|Q9I7M2|GTPBA_DROME GTP-binding protein 10 homolog OS=Drosophila melanogaster GN=CG10628 PE=2 SV=2 14 126 8.0E-07
sp|A2BP15|OBG_PROMS GTPase Obg OS=Prochlorococcus marinus (strain AS9601) GN=obg PE=3 SV=1 24 152 8.0E-07
sp|A0ZZZ0|OBG_BIFAA GTPase Obg OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=obg PE=3 SV=1 14 125 8.0E-07
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 24 152 8.0E-07
sp|C0QLE9|OBG_DESAH GTPase Obg OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=obg PE=3 SV=1 24 161 8.0E-07
sp|A5CX17|OBG_VESOH GTPase Obg OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=obg PE=3 SV=1 24 161 8.0E-07
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 15 123 8.0E-07
sp|Q4QM31|OBG_HAEI8 GTPase Obg OS=Haemophilus influenzae (strain 86-028NP) GN=obg PE=3 SV=1 24 151 8.0E-07
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 24 155 9.0E-07
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 24 155 9.0E-07
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 24 161 9.0E-07
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 24 154 9.0E-07
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|A8G2M6|OBG_PROM2 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9215) GN=obg PE=3 SV=1 24 152 1.0E-06
sp|B8DVU1|OBG_BIFA0 GTPase Obg OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=obg PE=3 SV=1 14 151 1.0E-06
sp|B1I5V8|OBG_DESAP GTPase Obg OS=Desulforudis audaxviator (strain MP104C) GN=obg PE=3 SV=1 24 155 1.0E-06
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 24 152 1.0E-06
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 24 135 1.0E-06
sp|Q5WTF1|OBG_LEGPL GTPase Obg OS=Legionella pneumophila (strain Lens) GN=obg PE=3 SV=1 24 197 1.0E-06
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 23 151 1.0E-06
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 23 151 1.0E-06
sp|Q21YZ9|OBG_RHOFT GTPase Obg OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=obg PE=3 SV=1 6 123 1.0E-06
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 24 154 1.0E-06
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 3 123 1.0E-06
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 24 123 1.0E-06
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 24 123 1.0E-06
sp|A7GHK2|OBG_CLOBL GTPase Obg OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=obg PE=3 SV=1 24 193 1.0E-06
sp|P95758|OBG_STRGR GTPase Obg OS=Streptomyces griseus GN=obg PE=1 SV=1 14 153 1.0E-06
sp|B1VXD8|OBG_STRGG GTPase Obg OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=obg PE=3 SV=1 14 153 1.0E-06
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 24 142 1.0E-06
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 24 123 1.0E-06
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 14 151 1.0E-06
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 24 153 1.0E-06
sp|A3PAT7|OBG_PROM0 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9301) GN=obg PE=3 SV=1 24 152 1.0E-06
sp|Q0AKX2|OBG_MARMM GTPase Obg OS=Maricaulis maris (strain MCS10) GN=obg PE=3 SV=1 24 168 1.0E-06
sp|Q5X1P1|OBG_LEGPA GTPase Obg OS=Legionella pneumophila (strain Paris) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|Q5ZS70|OBG_LEGPH GTPase Obg OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=obg PE=3 SV=2 24 161 1.0E-06
sp|B2JHD7|OBG_BURP8 GTPase Obg OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=obg PE=3 SV=1 24 161 1.0E-06
sp|Q0AHG5|OBG_NITEC GTPase Obg OS=Nitrosomonas eutropha (strain C91) GN=obg PE=3 SV=1 24 152 2.0E-06
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 24 152 2.0E-06
sp|A5IAS7|OBG_LEGPC GTPase Obg OS=Legionella pneumophila (strain Corby) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q3YRX8|OBG_EHRCJ GTPase Obg OS=Ehrlichia canis (strain Jake) GN=obg PE=3 SV=1 24 187 2.0E-06
sp|Q6DHF7|GTPBA_DANRE GTP-binding protein 10 OS=Danio rerio GN=gtpbp10 PE=2 SV=1 24 125 2.0E-06
sp|A9BK05|OBG_PETMO GTPase Obg OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=obg PE=3 SV=1 24 170 2.0E-06
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 23 123 2.0E-06
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 24 142 2.0E-06
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 24 142 2.0E-06
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q9PQ29|OBG_UREPA GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=obg PE=3 SV=1 24 140 2.0E-06
sp|B1AJA2|OBG_UREP2 GTPase Obg OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=obg PE=3 SV=1 24 140 2.0E-06
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|B9JUH9|OBG_AGRVS GTPase Obg OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=obg PE=3 SV=1 23 125 2.0E-06
sp|Q3BW46|OBG_XANC5 GTPase Obg OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|Q2G983|OBG_NOVAD GTPase Obg OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=obg PE=3 SV=2 23 151 2.0E-06
sp|Q7VDW9|OBG_PROMA GTPase Obg OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=obg PE=3 SV=1 24 202 2.0E-06
sp|Q3AM97|OBG_SYNSC GTPase Obg OS=Synechococcus sp. (strain CC9605) GN=obg PE=3 SV=1 24 151 2.0E-06
sp|Q0AAD6|OBG_ALKEH GTPase Obg OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=obg PE=3 SV=1 24 123 2.0E-06
sp|Q3SKG2|OBG_THIDA GTPase Obg OS=Thiobacillus denitrificans (strain ATCC 25259) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q8PN23|OBG_XANAC GTPase Obg OS=Xanthomonas axonopodis pv. citri (strain 306) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|A5UI23|OBG_HAEIG GTPase Obg OS=Haemophilus influenzae (strain PittGG) GN=obg PE=3 SV=1 24 151 2.0E-06
sp|A5UDJ7|OBG_HAEIE GTPase Obg OS=Haemophilus influenzae (strain PittEE) GN=obg PE=3 SV=1 24 151 2.0E-06
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 24 161 2.0E-06
sp|Q10XA1|OBG_TRIEI GTPase Obg OS=Trichodesmium erythraeum (strain IMS101) GN=obg PE=3 SV=1 24 168 2.0E-06
sp|A0LCZ3|OBG_MAGMM GTPase Obg OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=obg PE=3 SV=1 24 223 2.0E-06
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|A2SD36|OBG_METPP GTPase Obg OS=Methylibium petroleiphilum (strain PM1) GN=obg PE=3 SV=1 24 132 3.0E-06
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 24 113 3.0E-06
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 24 113 3.0E-06
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 24 161 3.0E-06
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|Q13U15|OBG_BURXL GTPase Obg OS=Burkholderia xenovorans (strain LB400) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|Q0SR54|OBG_CLOPS GTPase Obg OS=Clostridium perfringens (strain SM101 / Type A) GN=obg PE=3 SV=1 24 152 3.0E-06
sp|Q8XIJ2|OBG_CLOPE GTPase Obg OS=Clostridium perfringens (strain 13 / Type A) GN=obg PE=3 SV=1 24 152 3.0E-06
sp|Q0TNI5|OBG_CLOP1 GTPase Obg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=obg PE=3 SV=1 24 152 3.0E-06
sp|A4XAG1|OBG_SALTO GTPase Obg OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=obg PE=3 SV=1 14 151 3.0E-06
sp|Q12F99|OBG_POLSJ GTPase Obg OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 24 161 3.0E-06
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 23 123 3.0E-06
sp|A4G8R4|OBG_HERAR GTPase Obg OS=Herminiimonas arsenicoxydans GN=obg PE=3 SV=1 24 161 4.0E-06
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 14 161 4.0E-06
sp|Q8PBH0|OBG_XANCP GTPase Obg OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=obg PE=3 SV=1 24 161 4.0E-06
sp|B0RY32|OBG_XANCB GTPase Obg OS=Xanthomonas campestris pv. campestris (strain B100) GN=obg PE=3 SV=1 24 161 4.0E-06
sp|Q4US36|OBG_XANC8 GTPase Obg OS=Xanthomonas campestris pv. campestris (strain 8004) GN=obg PE=3 SV=1 24 161 4.0E-06
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 24 151 4.0E-06
sp|Q89ZI9|OBG_BACTN GTPase Obg OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=obg PE=3 SV=1 24 199 4.0E-06
sp|B3R898|OBG_CUPTR GTPase Obg OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=obg PE=3 SV=1 24 161 5.0E-06
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 23 123 5.0E-06
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 24 155 5.0E-06
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|B9JER1|OBG_AGRRK GTPase Obg OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=obg PE=3 SV=1 23 123 5.0E-06
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 24 155 5.0E-06
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 24 161 6.0E-06
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 24 155 6.0E-06
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 14 161 6.0E-06
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 14 161 6.0E-06
sp|Q8EWL0|OBG_MYCPE GTPase Obg OS=Mycoplasma penetrans (strain HF-2) GN=obg PE=3 SV=1 24 163 6.0E-06
sp|B1YSU7|OBG_BURA4 GTPase Obg OS=Burkholderia ambifaria (strain MC40-6) GN=obg PE=3 SV=1 24 161 6.0E-06
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 23 123 7.0E-06
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 24 142 7.0E-06
sp|A1AW67|OBG_RUTMC GTPase Obg OS=Ruthia magnifica subsp. Calyptogena magnifica GN=obg PE=3 SV=1 24 161 7.0E-06
sp|Q64XA5|OBG_BACFR GTPase Obg OS=Bacteroides fragilis (strain YCH46) GN=obg PE=3 SV=1 24 199 8.0E-06
sp|Q5LGG9|OBG_BACFN GTPase Obg OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=obg PE=3 SV=2 24 199 8.0E-06
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 24 151 8.0E-06
sp|Q0BIH8|OBG_BURCM GTPase Obg OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=obg PE=3 SV=1 24 161 8.0E-06
sp|A8L1V6|OBG_FRASN GTPase Obg OS=Frankia sp. (strain EAN1pec) GN=obg PE=3 SV=1 14 151 8.0E-06
sp|A8M0Y9|OBG_SALAI GTPase Obg OS=Salinispora arenicola (strain CNS-205) GN=obg PE=3 SV=1 14 151 9.0E-06
sp|Q39JU7|OBG_BURL3 GTPase Obg OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 24 197 9.0E-06
sp|Q5H2E5|OBG_XANOR GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|B2STC0|OBG_XANOP GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|Q2P5B4|OBG_XANOM GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=obg PE=3 SV=1 24 161 9.0E-06
sp|A0K4B0|OBG_BURCH GTPase Obg OS=Burkholderia cenocepacia (strain HI2424) GN=obg PE=3 SV=1 24 161 1.0E-05
sp|B1JVA1|OBG_BURCC GTPase Obg OS=Burkholderia cenocepacia (strain MC0-3) GN=obg PE=3 SV=1 24 161 1.0E-05
sp|A9AI60|OBG_BURM1 GTPase Obg OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=obg PE=3 SV=1 24 161 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4183
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|152 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8095
Ophiocordyceps camponoti-floridani Ophcf2|04703
Ophiocordyceps camponoti-rufipedis Ophun1|6412
Ophiocordyceps kimflemingae Ophio5|5132
Ophiocordyceps subramaniannii Hirsu2|8497

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|152
MPPKKQAQEEKIPLGRPGNNLKSGIVGLANVGKSTLFQAITKCSLGNPANFPYATIEPEEARVIVPDARFDWLCQ
KYKPKSQVPANLTVYDIAGLTRGSSTGAGLGNAFLSHIRAVDAIFQVVRCFDDAEIIHVEGDVNPTRDLDIIGEE
LRLKDIEFVEKALENQKKKTRMGGQSLELKKAKLEQEIIEKILAWLQDGKDVRKGNWGPKEIEVINPLFLLTAKP
VVYLANLSEKDFVRKKNKHLPKVAEWIKEHAEGDPLIPLSVAYEERLTRFETEQEAKEEQKKVGAESALPKIIVQ
MRKTLQLGSFFTTGADEVRQWTIRTGTKAPQAAGVIHTDFEKTFIQAIVCNYDALKEYGDEAEVKAHGKMMTKGK
DYVVEDGDILLIKAGAAKG*
Coding >OphauG2|152
ATGCCGCCCAAGAAGCAGGCTCAAGAAGAAAAGATTCCCCTGGGAAGACCAGGCAACAATCTCAAAAGTGGCATC
GTTGGCCTCGCAAACGTGGGAAAATCCACTTTGTTCCAGGCCATCACAAAATGCTCCCTCGGCAACCCAGCTAAC
TTCCCCTATGCTACCATAGAGCCGGAAGAGGCTCGCGTCATTGTCCCTGATGCTCGGTTCGACTGGTTGTGTCAA
AAGTACAAGCCCAAGTCTCAGGTCCCAGCCAATCTCACTGTCTACGACATTGCAGGTTTAACGCGCGGCTCCTCA
ACCGGTGCTGGCCTCGGCAATGCATTTTTGTCCCATATTCGCGCCGTCGATGCCATTTTCCAGGTTGTCCGATGC
TTCGACGATGCTGAAATTATTCACGTCGAGGGCGATGTGAATCCTACTCGCGATCTCGACATCATCGGCGAAGAA
CTAAGACTCAAGGACATTGAGTTTGTAGAGAAGGCGCTAGAGAACCAAAAGAAGAAGACGCGCATGGGAGGCCAG
AGCCTGGAGCTTAAAAAAGCCAAGCTAGAGCAGGAAATTATCGAAAAGATTCTTGCCTGGCTTCAGGATGGCAAA
GACGTGCGCAAGGGCAATTGGGGACCCAAGGAGATTGAAGTCATCAATCCACTCTTTCTCCTGACGGCCAAGCCG
GTTGTATATCTGGCAAATTTGTCTGAAAAGGACTTTGTACGCAAGAAGAATAAGCATTTGCCAAAGGTGGCTGAG
TGGATCAAGGAGCACGCAGAGGGGGATCCCTTGATTCCGCTGTCGGTGGCGTATGAGGAGCGGCTGACGCGCTTT
GAAACGGAGCAAGAGGCCAAGGAGGAACAGAAAAAGGTGGGCGCCGAGTCTGCGCTGCCCAAGATTATTGTGCAG
ATGCGCAAGACGCTGCAGCTGGGCAGCTTCTTCACGACGGGCGCCGACGAGGTGCGTCAGTGGACGATTCGCACG
GGCACCAAGGCGCCCCAGGCAGCGGGCGTCATTCACACCGACTTTGAAAAGACGTTTATCCAGGCCATTGTGTGC
AACTATGATGCGCTCAAGGAGTATGGCGACGAGGCCGAGGTCAAGGCGCACGGCAAGATGATGACCAAGGGCAAG
GACTATGTTGTTGAGGATGGAGACATTTTGCTCATCAAGGCTGGTGCTGCCAAGGGTTAG
Transcript >OphauG2|152
ATGCCGCCCAAGAAGCAGGCTCAAGAAGAAAAGATTCCCCTGGGAAGACCAGGCAACAATCTCAAAAGTGGCATC
GTTGGCCTCGCAAACGTGGGAAAATCCACTTTGTTCCAGGCCATCACAAAATGCTCCCTCGGCAACCCAGCTAAC
TTCCCCTATGCTACCATAGAGCCGGAAGAGGCTCGCGTCATTGTCCCTGATGCTCGGTTCGACTGGTTGTGTCAA
AAGTACAAGCCCAAGTCTCAGGTCCCAGCCAATCTCACTGTCTACGACATTGCAGGTTTAACGCGCGGCTCCTCA
ACCGGTGCTGGCCTCGGCAATGCATTTTTGTCCCATATTCGCGCCGTCGATGCCATTTTCCAGGTTGTCCGATGC
TTCGACGATGCTGAAATTATTCACGTCGAGGGCGATGTGAATCCTACTCGCGATCTCGACATCATCGGCGAAGAA
CTAAGACTCAAGGACATTGAGTTTGTAGAGAAGGCGCTAGAGAACCAAAAGAAGAAGACGCGCATGGGAGGCCAG
AGCCTGGAGCTTAAAAAAGCCAAGCTAGAGCAGGAAATTATCGAAAAGATTCTTGCCTGGCTTCAGGATGGCAAA
GACGTGCGCAAGGGCAATTGGGGACCCAAGGAGATTGAAGTCATCAATCCACTCTTTCTCCTGACGGCCAAGCCG
GTTGTATATCTGGCAAATTTGTCTGAAAAGGACTTTGTACGCAAGAAGAATAAGCATTTGCCAAAGGTGGCTGAG
TGGATCAAGGAGCACGCAGAGGGGGATCCCTTGATTCCGCTGTCGGTGGCGTATGAGGAGCGGCTGACGCGCTTT
GAAACGGAGCAAGAGGCCAAGGAGGAACAGAAAAAGGTGGGCGCCGAGTCTGCGCTGCCCAAGATTATTGTGCAG
ATGCGCAAGACGCTGCAGCTGGGCAGCTTCTTCACGACGGGCGCCGACGAGGTGCGTCAGTGGACGATTCGCACG
GGCACCAAGGCGCCCCAGGCAGCGGGCGTCATTCACACCGACTTTGAAAAGACGTTTATCCAGGCCATTGTGTGC
AACTATGATGCGCTCAAGGAGTATGGCGACGAGGCCGAGGTCAAGGCGCACGGCAAGATGATGACCAAGGGCAAG
GACTATGTTGTTGAGGATGGAGACATTTTGCTCATCAAGGCTGGTGCTGCCAAGGGTTAG
Gene >OphauG2|152
ATGCCGCCCAAGAAGCAGGCTCAAGAAGAAAAGATTCCCCTGGGAAGACCAGGCAACAATCTCAAAAGTGGCATC
GTGAGCACCGCCAAAGCAGCACACGTGCCCAACTCTCGCTAAGCTCAGCAGGTTGGCCTCGCAAACGTGGGAAAA
TCCACTTTGTTCCAGGCCATCACAAAATGCTCCCTCGGCAACCCAGCTGTATGACGCTCCCTCCAGCCGCCCGCT
CTAGGCCGTCAGGGCGCTGACAGCTTGCAAAAAGAACTTCCCCTATGCTACCATAGAGCCGGAAGAGGCTCGCGT
CATTGTCCCTGATGCTCGGTTCGACTGGTTGTGTCAAAAGTACAAGCCCAAGTCTCAGGTCCCAGCCAATCTCAC
TGTCTACGACATTGCAGGTTTAACGCGCGGCTCCTCAACCGGTGCTGGCCTCGGCAATGCATTTTTGTCCCATAT
TCGCGCCGTCGATGCCATTTTCCAGGTTGTCCGATGCTTCGACGATGCTGAAATTATTCACGTCGAGGGCGATGT
GAATCCTACTCGCGATCTCGACATCATCGGCGAAGAACTAAGACTCAAGGACATTGAGTTTGTAGAGAAGGCGCT
AGAGAACCAAAAGAAGAAGACGCGCATGGGAGGCCAGAGCCTGGAGCTTAAAAAAGCCAAGCTAGAGCAGGAAAT
TATCGAAAAGATTCTTGCCTGGCTTCAGGATGGCAAAGACGTGCGCAAGGGCAATTGGGGACCCAAGGAGGTAGG
CCATGTCCCAAATTTGTCTCTTTCTTGTTTGTTGCATGATGACAAAAGGCCATTTGGCCTGAATCTAATCCCAGC
TCTTTGAATGCCTCACCCAAACAACGCTAGAGTGCATCGTGAGATGAAATTTTACCTGACAGCAGTGTTTTTACC
ATGGGCAACAGACGTTTACAATTATTATTGCAATATGTACTGACTTGGGCCATAGATTGAAGTCATCAATCCACT
CTTTCTCCTGACGGCCAAGCCGGTTGTATATCTGGCAAATTTGTCTGAAAAGGACTTTGTACGCAAGAAGAATAA
GCATTTGCCAAAGGTGGCTGAGTGGATCAAGGAGCACGCAGAGGGGGATCCCTTGATTCCGCTGTCGGTGGCGTA
TGAGGAGCGGCTGACGCGCTTTGAAACGGAGCAAGAGGCCAAGGAGGAACAGAAAAAGGTGGGCGCCGAGTCTGC
GCTGCCCAAGATTATTGTGCAGATGCGCAAGACGCTGCAGCTGGGCAGCTTCTTCACGACGGGCGCCGACGAGGT
GCGTCAGTGGACGATTCGCACGGGCACCAAGGCGCCCCAGGCAGCGGGCGTCATTCACACCGACTTTGAAAAGAC
GTTTATCCAGGCCATTGTGTGCAACTATGATGCGCTCAAGGAGTATGGCGACGAGGCCGAGGTCAAGGCGCACGG
CAAGATGATGACCAAGGGCAAGGACTATGTTGTTGAGGATGGAGACATTTTGCTCATCAAGGCTGGTGCTGCCAA
GGGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail