Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1519
Gene name
LocationContig_1461:168..1355
Strand+
Gene length (bp)1187
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02926 THUMP THUMP domain 7.8E-11 141 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53072|TAN1_YEAST tRNA acetyltransferase TAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAN1 PE=1 SV=1 52 297 3.0E-27
sp|Q99J36|THUM1_MOUSE THUMP domain-containing protein 1 OS=Mus musculus GN=Thumpd1 PE=1 SV=1 42 296 4.0E-19
sp|Q24K03|THUM1_BOVIN THUMP domain-containing protein 1 OS=Bos taurus GN=THUMPD1 PE=2 SV=1 52 296 4.0E-19
sp|Q9NXG2|THUM1_HUMAN THUMP domain-containing protein 1 OS=Homo sapiens GN=THUMPD1 PE=1 SV=2 1 296 3.0E-18
sp|P87151|YB0A_SCHPO Uncharacterized protein C25H2.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.10c PE=3 SV=2 50 297 6.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53072|TAN1_YEAST tRNA acetyltransferase TAN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAN1 PE=1 SV=1 52 297 3.0E-27
sp|Q99J36|THUM1_MOUSE THUMP domain-containing protein 1 OS=Mus musculus GN=Thumpd1 PE=1 SV=1 42 296 4.0E-19
sp|Q24K03|THUM1_BOVIN THUMP domain-containing protein 1 OS=Bos taurus GN=THUMPD1 PE=2 SV=1 52 296 4.0E-19
sp|Q9NXG2|THUM1_HUMAN THUMP domain-containing protein 1 OS=Homo sapiens GN=THUMPD1 PE=1 SV=2 1 296 3.0E-18
sp|P87151|YB0A_SCHPO Uncharacterized protein C25H2.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25H2.10c PE=3 SV=2 50 297 6.0E-17
sp|Q9VZD8|THUM1_DROME THUMP domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG15014 PE=1 SV=2 51 301 8.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1519
MTESVQKTKQRPGAWALQGKDSKKAKCGAGGRWKTPHHKAKAADKAKMGTALEVGDAGIWVTFVRGMGSKAVREF
RELCDEYGETLYGLKRPGAEEGVGVEQADQDESIEASVQRELSVMKAEQQEKPDSGAFSMVKTGLECLVFIKTLA
PVNAGELVVKMCEDARDCGDARRRKVKYINRLTPVVDTNKATERGMERVARTVLAPHFGLADGGGKQAIGDASTY
AVRYKIRKHGGALTSSHVISQVAGLIHGRHRVDLEQPDKVILVEIFQLFCGMAVVDGREWEELKRYNMHQLYGMH
D*
Coding >OphauG2|1519
ATGACAGAAAGTGTCCAAAAAACAAAGCAAAGACCGGGGGCGTGGGCTTTGCAAGGCAAGGACAGCAAGAAGGCC
AAGTGCGGGGCAGGCGGGCGATGGAAAACGCCGCATCACAAAGCAAAGGCAGCGGATAAGGCAAAGATGGGCACA
GCACTCGAGGTGGGAGACGCGGGAATTTGGGTCACGTTTGTCAGAGGCATGGGATCCAAGGCGGTGCGTGAGTTT
AGAGAGCTATGTGACGAGTACGGCGAGACGTTGTACGGCCTGAAGCGGCCTGGGGCAGAAGAAGGGGTGGGGGTA
GAGCAAGCTGATCAAGATGAAAGCATTGAAGCATCGGTGCAGCGCGAACTCAGTGTCATGAAGGCGGAGCAGCAG
GAGAAGCCGGACAGCGGAGCTTTCAGCATGGTCAAGACGGGACTTGAGTGCTTGGTGTTTATCAAGACGCTAGCC
CCGGTGAATGCGGGAGAACTGGTTGTCAAGATGTGCGAGGACGCGAGAGACTGTGGCGATGCGCGACGGCGCAAG
GTCAAGTACATCAACCGACTGACCCCCGTTGTCGACACGAACAAGGCGACGGAACGAGGCATGGAGCGGGTTGCA
CGGACAGTGCTGGCGCCGCATTTTGGCCTGGCGGATGGCGGCGGCAAGCAAGCCATTGGCGATGCATCTACATAT
GCGGTGCGCTACAAGATACGAAAGCACGGCGGCGCCTTGACTTCGAGCCACGTCATCAGCCAGGTTGCAGGTCTT
ATTCATGGCCGGCACAGGGTTGACTTGGAGCAGCCGGACAAGGTGATTCTGGTGGAGATTTTCCAGCTGTTTTGT
GGCATGGCTGTCGTTGATGGCCGGGAATGGGAGGAGCTCAAGAGATACAACATGCACCAGCTTTACGGCATGCAC
GACTAA
Transcript >OphauG2|1519
ATGACAGAAAGTGTCCAAAAAACAAAGCAAAGACCGGGGGCGTGGGCTTTGCAAGGCAAGGACAGCAAGAAGGCC
AAGTGCGGGGCAGGCGGGCGATGGAAAACGCCGCATCACAAAGCAAAGGCAGCGGATAAGGCAAAGATGGGCACA
GCACTCGAGGTGGGAGACGCGGGAATTTGGGTCACGTTTGTCAGAGGCATGGGATCCAAGGCGGTGCGTGAGTTT
AGAGAGCTATGTGACGAGTACGGCGAGACGTTGTACGGCCTGAAGCGGCCTGGGGCAGAAGAAGGGGTGGGGGTA
GAGCAAGCTGATCAAGATGAAAGCATTGAAGCATCGGTGCAGCGCGAACTCAGTGTCATGAAGGCGGAGCAGCAG
GAGAAGCCGGACAGCGGAGCTTTCAGCATGGTCAAGACGGGACTTGAGTGCTTGGTGTTTATCAAGACGCTAGCC
CCGGTGAATGCGGGAGAACTGGTTGTCAAGATGTGCGAGGACGCGAGAGACTGTGGCGATGCGCGACGGCGCAAG
GTCAAGTACATCAACCGACTGACCCCCGTTGTCGACACGAACAAGGCGACGGAACGAGGCATGGAGCGGGTTGCA
CGGACAGTGCTGGCGCCGCATTTTGGCCTGGCGGATGGCGGCGGCAAGCAAGCCATTGGCGATGCATCTACATAT
GCGGTGCGCTACAAGATACGAAAGCACGGCGGCGCCTTGACTTCGAGCCACGTCATCAGCCAGGTTGCAGGTCTT
ATTCATGGCCGGCACAGGGTTGACTTGGAGCAGCCGGACAAGGTGATTCTGGTGGAGATTTTCCAGCTGTTTTGT
GGCATGGCTGTCGTTGATGGCCGGGAATGGGAGGAGCTCAAGAGATACAACATGCACCAGCTTTACGGCATGCAC
GACTAA
Gene >OphauG2|1519
ATGACAGAAAGTGTCCAAAAAACAAAGCAAAGACCGGGGGCGTGGGCTTTGCAAGGCAAGGACAGCAAGAAGGCC
AAGGTAAGAGAAGGGACAGTACCATAAATATGGCGATAGTGAGGACTTTGTAAGTTGGAACAAACGACTAGGACT
GACAGTGATATTTTACCAAAACAGTGCGGGGCAGGCGGGCGATGGAAAACGCCGCATCACAAAGCAAAGGCAGCG
GATAAGGCAAAGATGGGCACAGCACTCGAGGTGGGAGACGCGGGAATTTGGGTCACGTTTGTCAGAGGCATGGGA
TCCAAGGCGGTGCGTGAGTTTAGAGAGCTATGTGACGAGGTATGGCTGCCAAGCTTTGTCAAGCTGGAGGATGGA
AGCAAGGCTAACAAGGGGCGTGGTCAAGTACGGCGAGACGTTGTACGGCCTGAAGCGGCCTGGGGCAGAAGAAGG
GGTGGGGGTAGAGCAAGCTGATCAAGATGAAAGCATTGAAGCATCGGTGCAGCGCGAACTCAGTGTCATGAAGGC
GGAGCAGCAGGAGAAGCCGGACAGCGGAGCTTTCAGCATGGTCAAGACGGGACTTGAGTGCTTGGTGTTTATCAA
GACGCTAGCCCCGGTGAATGCGGGAGAACTGGTTGTCAAGATGTGCGAGGACGCGAGAGACTGTGGCGATGCGCG
ACGGCGCAAGGTCAAGTACATCAACCGACTGACCCCCGTTGTCGACACGAACAAGGCGACGGAACGAGGCATGGA
GCGGGTTGCACGGACAGTGCTGGCGCCGCATTTTGGCCTGGCGGATGGCGGCGGCAAGCAAGCCATTGGCGATGC
ATCTACAGTACGTCGTTGGAGGGACAAGAGCCCATTGAGGTGGGAGAGCGGGCTGACGGGCGCCTCTGGCAGTAT
GCGGTGCGCTACAAGATACGAAAGCACGGCGGCGCCTTGACTTCGAGCCACGTCATCAGCCAGGTTGCAGGTCTT
ATTCATGGCCGGCACAGGGTTGACTTGGAGCAGCCGGACAAGGTGATTCTGGTGGAGATTTTCCAGGTATGTCAA
TGGGTCTGGCGAATGGCATGGCGCGGGCTGACGCACCAGGACCAAAGCTGTTTTGTGGCATGGCTGTCGTTGATG
GCCGGGAATGGGAGGAGCTCAAGAGATACAACATGCACCAGCTTTACGGCATGCACGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail