Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1516
Gene name
LocationContig_146:28200..28971
Strand+
Gene length (bp)771
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10356 DUF2034 Protein of unknown function (DUF2034) 9.4E-10 73 118
PF10356 DUF2034 Protein of unknown function (DUF2034) 2.1E-12 128 220
PF04471 Mrr_cat Restriction endonuclease 2.6E-06 79 158

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UT40|YIQ3_SCHPO Uncharacterized protein C824.03c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.03c PE=4 SV=1 54 213 5.0E-13

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0009307 DNA restriction-modification system Yes
GO:0004519 endonuclease activity Yes
GO:0006259 DNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0044355 clearance of foreign intracellular DNA No
GO:0016787 hydrolase activity No
GO:0043412 macromolecule modification No
GO:0098542 defense response to other organism No
GO:0008152 metabolic process No
GO:0006950 response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0009605 response to external stimulus No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0099046 clearance of foreign intracellular nucleic acids No
GO:0009607 response to biotic stimulus No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0006304 DNA modification No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006952 defense response No
GO:0003824 catalytic activity No
GO:0051707 response to other organism No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044419 biological process involved in interspecies interaction between organisms No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0043207 response to external biotic stimulus No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0050896 response to stimulus No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6335
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1516 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1193
Ophiocordyceps camponoti-floridani Ophcf2|02787
Ophiocordyceps camponoti-rufipedis Ophun1|5698
Ophiocordyceps kimflemingae Ophio5|5278

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1516
MLVVRYRSCGRSWRRAHLVPRVGIQRQWYSSGNNENSKDDSHVVNRAKPTWTQHSDLATFLSYAQRSGLDPKSTT
YVGTHYEYTVAAALFGYGFTLKRIGGVSDRGTDLIGMWTLPTRRTSGSSWPLALRVVVQCKYGSGRGRVGPQHVR
ELEGAFAGAPAGWRGGGVVGVLVGEAAATRGVRDALGRSRWPMVFASCSREGRVEQLLWNGRAEEEGLEGLSVGV
RHGQDQSRWELVLLHHGQVARWRGTARHSEA*
Coding >OphauG2|1516
ATGCTGGTGGTGCGGTATCGCTCATGTGGCCGCTCATGGCGGCGGGCGCATCTCGTGCCTAGAGTCGGGATACAG
AGACAATGGTATAGCAGCGGCAACAACGAGAATAGCAAGGACGACAGCCATGTGGTGAATCGTGCAAAGCCAACA
TGGACGCAACACTCTGATCTGGCCACATTCCTGTCGTATGCGCAGCGCAGCGGACTGGACCCCAAGTCGACGACG
TACGTGGGCACGCACTACGAGTACACGGTTGCGGCGGCACTGTTTGGATACGGCTTCACGCTCAAGCGCATTGGC
GGCGTGTCAGACCGCGGGACGGACCTGATTGGCATGTGGACGCTGCCGACGCGGCGCACAAGCGGCTCGTCGTGG
CCGCTGGCGCTCCGCGTGGTGGTGCAGTGCAAGTACGGGAGTGGACGAGGCCGCGTTGGGCCGCAGCACGTTCGC
GAGCTGGAGGGGGCCTTTGCGGGGGCGCCTGCAGGCTGGAGGGGAGGCGGCGTTGTGGGTGTCTTGGTGGGCGAG
GCGGCGGCAACACGGGGCGTGAGAGACGCGCTGGGGCGCAGTCGCTGGCCCATGGTGTTTGCGTCGTGCTCGCGA
GAGGGTCGTGTCGAGCAGCTGCTGTGGAACGGGCGGGCTGAGGAGGAAGGCCTGGAGGGCCTCAGCGTTGGAGTC
CGACACGGACAAGACCAATCACGTTGGGAGCTGGTTCTTTTACACCACGGCCAAGTTGCGCGTTGGCGAGGCACA
GCGAGGCACAGCGAGGCATAG
Transcript >OphauG2|1516
ATGCTGGTGGTGCGGTATCGCTCATGTGGCCGCTCATGGCGGCGGGCGCATCTCGTGCCTAGAGTCGGGATACAG
AGACAATGGTATAGCAGCGGCAACAACGAGAATAGCAAGGACGACAGCCATGTGGTGAATCGTGCAAAGCCAACA
TGGACGCAACACTCTGATCTGGCCACATTCCTGTCGTATGCGCAGCGCAGCGGACTGGACCCCAAGTCGACGACG
TACGTGGGCACGCACTACGAGTACACGGTTGCGGCGGCACTGTTTGGATACGGCTTCACGCTCAAGCGCATTGGC
GGCGTGTCAGACCGCGGGACGGACCTGATTGGCATGTGGACGCTGCCGACGCGGCGCACAAGCGGCTCGTCGTGG
CCGCTGGCGCTCCGCGTGGTGGTGCAGTGCAAGTACGGGAGTGGACGAGGCCGCGTTGGGCCGCAGCACGTTCGC
GAGCTGGAGGGGGCCTTTGCGGGGGCGCCTGCAGGCTGGAGGGGAGGCGGCGTTGTGGGTGTCTTGGTGGGCGAG
GCGGCGGCAACACGGGGCGTGAGAGACGCGCTGGGGCGCAGTCGCTGGCCCATGGTGTTTGCGTCGTGCTCGCGA
GAGGGTCGTGTCGAGCAGCTGCTGTGGAACGGGCGGGCTGAGGAGGAAGGCCTGGAGGGCCTCAGCGTTGGAGTC
CGACACGGACAAGACCAATCACGTTGGGAGCTGGTTCTTTTACACCACGGCCAAGTTGCGCGTTGGCGAGGCACA
GCGAGGCACAGCGAGGCATAG
Gene >OphauG2|1516
ATGCTGGTGGTGCGGTATCGCTCATGTGGCCGCTCATGGCGGCGGGCGCATCTCGTGCCTAGAGTCGGGATACAG
AGACAATGGTATAGCAGCGGCAACAACGAGAATAGCAAGGACGACAGCCATGTGGTGAATCGTGCAAAGCCAACA
TGGACGCAACACTCTGATCTGGCCACATTCCTGTCGTATGCGCAGCGCAGCGGACTGGACCCCAAGTCGACGACG
TACGTGGGCACGCACTACGAGTACACGGTTGCGGCGGCACTGTTTGGATACGGCTTCACGCTCAAGCGCATTGGC
GGCGTGTCAGACCGCGGGACGGACCTGATTGGCATGTGGACGCTGCCGACGCGGCGCACAAGCGGCTCGTCGTGG
CCGCTGGCGCTCCGCGTGGTGGTGCAGTGCAAGTACGGGAGTGGACGAGGCCGCGTTGGGCCGCAGCACGTTCGC
GAGCTGGAGGGGGCCTTTGCGGGGGCGCCTGCAGGCTGGAGGGGAGGCGGCGTTGTGGGTGTCTTGGTGGGCGAG
GCGGCGGCAACACGGGGCGTGAGAGACGCGCTGGGGCGCAGTCGCTGGCCCATGGTGTTTGCGTCGTGCTCGCGA
GAGGGTCGTGTCGAGCAGCTGCTGTGGAACGGGCGGGCTGAGGAGGAAGGCCTGGAGGGCCTCAGCGTTGGAGTC
CGACACGGACAAGACCAATCACGTTGGGAGCTGGTTCTTTTACACCACGGCCAAGTTGCGCGTTGGCGAGGCACA
GCGAGGCACAGCGAGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail